SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046549 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046549
Domain Number 1 Region: 153-432
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-18
Family RNA helicase 0.09
Further Details:      
 
Domain Number 2 Region: 730-837
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000363
Family Tandem AAA-ATPase domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046549   Gene: ENSTRUG00000018193   Transcript: ENSTRUT00000046707
Sequence length 1198
Comment pep:novel scaffold:FUGU4:scaffold_25:1563463:1575095:1 gene:ENSTRUG00000018193 transcript:ENSTRUT00000046707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLACIDELSTNSLFSSPADSLSEYADSQSFINADNLDTVPTIWDINTNTTNAPAQSQLE
VGCKPLHTHLLSIMLSSPLSSTVLSLCACHSLVNPFSIYWFQLSQAFFCIDIFLPLGNNT
LKLFCFQVQRTQPPPEEEEEAEEEETEELGHVDTYAEYKPSKSTIGISHPDIVVETNTLS
SVPPPDITYVLSLPETTIKGGLLSALQLEAIIYGCQQHEVILQNKQRAGFLIGDGAGVGK
GRTVAGIILENYLKGRKKALWFSISNDLKFDAERDLKDIDAPHIPVLALNKVSPGGIGDR
ARKIRLLIKYGDTATSEGVLFATYSALIGESQAGGQHRTRIKQILDWCKPDFDGVIIFDE
CHKAKNATSTKMGKAVLDLQNQLPRARVVYASATGASEPKNMIYMSRLGIWGEGTPFRTF
DDFLHAIEKRGVGAMEIVAMDMKVSGMYIARQLSFSGVSFRIEEIGLDNDFKLVYNKAAK
LWAEALQVFMRAADELGLVSRKSLWGQFWSSHQRFFKYLCIAAKVRCLVELAQKELEAGK
CIVVGLQSTGESRTREVLDENDGHLDRFVSAAEGVFQSLVTKHFPSEKQRREKAPGNKRK
RGVINISDDSSSDSDGMETDSNSSPDSLLDNDDVIFVNHTNGQTGSPLAPVILARIEEMK
QDLLHKISILGKELPLNTLDELIDKFGGPDKVSEMTGRRGRVVRRPDGSVRYESRAEQGL
TIDHINLKEKDRFMSGEKLVAIISEAASSGISLQADKRVKNQRRRVHMTLELPWSADRAI
QQFGRTHRSNQVTAPEYIFLISELAGERRFASIVAKRLESLGALTHGDRRATESRDLSKY
NFENKYGTKALDKITKSIMGHIENKVPPPKGYPGGCAMFFRDMKLGMMDVGILCKDPRFG
ISTEKDCSITKFLNRILGLEVHKQNYLFQYFTDNFDYLIEKDKKEGKYDMGILDNTKLLF
CSDTDLAPGNDEIYEEKQEIFLTAGNPQDGQVVLYKISVDRGMPWEEAYSRSLKLSGSDE
GFYLSLKLRGNHPCVLLAEQGRGKNFIVYKPNIGKQSQTESLDKLQQRYRKVAPEEAKDS
WENQFTFSFKKCSHANWNGKCKKIEEGQECLQGMRLRQYHMLCGALLRVWKRVADVVSDI
TSSSILQIVRLKTKQHNKQVGIKIPENCVARVREELLQMDEEDSKRERLPAAQSSSPP
Download sequence
Identical sequences H2VBF7
ENSTRUP00000046549 31033.ENSTRUP00000046549 ENSTRUP00000046549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]