SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000046695 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000046695
Domain Number 1 Region: 15-240
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.72e-76
Family Calponin-homology domain, CH-domain 0.000000815
Further Details:      
 
Domain Number 2 Region: 3077-3201
Classification Level Classification E-value
Superfamily EF-hand 6.52e-51
Family EF-hand modules in multidomain proteins 0.00000422
Further Details:      
 
Domain Number 3 Region: 3202-3298
Classification Level Classification E-value
Superfamily EF-hand 7.25e-37
Family EF-hand modules in multidomain proteins 0.0000138
Further Details:      
 
Domain Number 4 Region: 2061-2217
Classification Level Classification E-value
Superfamily Spectrin repeat 1.01e-23
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 5 Region: 3278-3366
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 6 Region: 403-561
Classification Level Classification E-value
Superfamily Spectrin repeat 5.24e-20
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 7 Region: 524-666
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-20
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 8 Region: 2742-2867
Classification Level Classification E-value
Superfamily Spectrin repeat 5.08e-17
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 9 Region: 1523-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-16
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 10 Region: 2893-3032
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 11 Region: 2517-2674
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000504
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 12 Region: 1233-1364
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000589
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 13 Region: 2183-2310
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000173
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 14 Region: 3039-3076
Classification Level Classification E-value
Superfamily WW domain 0.0000000000519
Family WW domain 0.00022
Further Details:      
 
Domain Number 15 Region: 1024-1117
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 16 Region: 1156-1265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000187
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 17 Region: 1652-1776
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000374
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 18 Region: 724-815
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000105
Family Spectrin repeat 0.007
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000046695
Domain Number - Region: 1336-1471
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000204
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number - Region: 2464-2530
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00374
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 1933-2067
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0863
Family Spectrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000046695   Gene: ENSTRUG00000018246   Transcript: ENSTRUT00000046853
Sequence length 3653
Comment pep:novel scaffold:FUGU4:scaffold_78:659579:755711:1 gene:ENSTRUG00000018246 transcript:ENSTRUT00000046853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVAHLLTFLASSSSSYEHDSVQKKTFTKWINAQFSKTGKTPIKDMFTDLKDGRKLLDLLE
GLTGATLTKERGSTRVHALNNVNKVLQVLHQNNVDLVNIGGTDIVDGNHKLTLGLIWSII
LHWQVKDIMKDVMANLQQTNSEKILLSWVRQCTGPYPEVNVLNFTTSWADGLALNSILHH
FRPGSFSWQQVLRMSPVERLEHAFTVAKDQLAIERLLDPEDVAVQLPDKKSILMYVTSLF
AVLPKDVSMEAIREVETLPRKYKAASEDTAAGLPAQEVEVFLLAKSTTVNHPKRLNEFPD
VKKCCSLKAQHAQANGEERRDLALPPTPTVASKCNYNLLKRDEVDLDGYQTTLEEVLTWL
LSAEDALQVQEEVSDDVEEVKDQFHTHEAYMMELTAHQSSVGNVLQAGNQLIAQGNLTEE
EENEIGEQMRLLNSRWENLRVDSMDRQARLHEVLMDLQQQQLQQLSDWLSQTEERIMKME
TEAPAKSLEIYKEQIEQHRELQNDLEAEQVKVNSLTHMVVVVDENSGESATAALEEQLQS
LGERWAAVCRWTEERWHKLQEVFLVWQQLLSDQSLFRAWLAEKEEALDQVQTSNFRDPSE
MNTNVRQLAILKEDMEKKRRVLDQLSEAGQDVMELLRSPEAGGKVEADTEELAHRWDNLV
QKLEDYSFQVMEAVTDAGIPQEDEQVIIGTVAVGTAASVTDLDSTPPASAEKQLVGMDPE
VTRIFETKCSELLSWVKTRKTSARMLASADPESTPGSSDLLADFKALELDLTTNEATVIQ
VIQEGRDLMDQMEREGVCVDSVKADVDLIQTEWDVCTRELQAASERVSTQSRVSTLSAEL
ADLDRTLREQDLWIASNSAIQKGNEETELRRQTGECEERIVLITALSPQLEQLSAEARSL
GAVPSLKDNIVVVSAHHASTLQQLENTKDELNKVLYETLANIRQKEEQKCIKDRDKRSRE
KSSIWMLTLTTLEVGKLKPGPVEALEVRLATLRDGVVDIHTTEGAVERAQIERTQKASDV
AELERWSQVSTKAREELATLQCALGSMKAYQVSLVEVERWLDAVQEMLSNDATGSSKRDN
LQEELNNCKEYMNEMESVDCALKQMGETVSALEGSGPVNWGQDKFTECQGRWESLSKQLL
VHQEQVAESQEKQVNLRKDLVEMQEWMAQVDEEFLMRDFEYKGPEELEASLEEMKRAKED
VLQKEVKVKILKDSIHLLVSRTSPSAGHSGLELTSELERVLANYNKLCDRFKSKCHTLEE
VWSCWIELLQYLDMEHSWLNTLEEKVKATDNLPESTEAVSEALESLESTLRHPGDNRTQI
RELGQTLVDGGILDELISEKLEAFNSRYEQLNHQAVNRQISLEQQLQTLKENEQALQTLQ
ESLSQLDHTLTSYLTDRIDAFQLPQEAQTIGAEIAAHELTVEDMKRRNVANLPPSTSEGK
ASRGGTMLDHLQRKLREISTKYQLFQKPANFEQRMLDCKRVLEGAKTELHVLDVKDVQPE
KIQLHLSGCMKLYKLLSEVKLEVETVIKTGRQIVQKQQTENPKAMDEQLTALKLLYNDLG
AQVTEGKQDLEKALSLSQKFQKETNMLQDWLITSEAQLQQKNSCGDMPADIDAEIAWANG
LLKETERRKVELSNLMETSAGLQTLVEGSGAQLEDKLCVLNEAWGQVRTLTEDWLSAVLS
HQNEVEIFDENLAHISTWLYQTQIHLDEAERLPPAEREKVVKRMLEELRDISLRVDNVKD
QAIILMTSRGPACRDVVEPKLSELNCNFDKVSQHIRTAQLIQNQEVQAESRPDETLVLTE
VKNLQAELQDTLTALQQQEPSDLLDEEKNTYSFSLQKKESFIMRKTYARHREKVIRMMGR
LIKIERHRHCCLYKLSALLILLLGLIQADWLLQFFKDAKLWRAKKKLSKVSVPTRTCVHS
FPLQQMDEEKAGVEDLLRRGEELMQQTSDESQREEFRLLLVRLQSQYSAHRELRMLRIRQ
LDVPMESTSQTLTDPTGEFLVEVRRSPSDYLVDINKVLLTMADNELLLNSSELSGGLYED
FSSQEDTLKNIKDNLESLGEQVAGLHEQQPDAIRDSSPAEVAQIADALTQLNAEWDRLNR
MYNHRKGSFDRAVEEWRQFHCDMNDLSQWLTDTERLMSESIGPDGQLDLDSAKQHQEELE
EGLASHQPIMAMLTRTGEQIIGQLSSPDGSLLEEKLDVLAQRWRGVSREALERQRMLAGG
DTALSDLVRRSKELSTWLEKAENAARSLPVAAADKNLKELKAVAEEMDAQNERLGWLNKH
APQILTGPTVSPHSKDQIVGKLRATNLKWSKKVTHELLDKIREVEANLQSHTQFEDKMNR
LTDWVIVTHQTIITRGLSSGQAQALEASMRDRKKDLEDLLAHSIELQRRQQLLPQEKSQV
EQLAADWKALDGRLRSIHQNFQRPIPSFPPTVVSAVPSAVQTVTLVSEELRQQRPHTPDT
VAPTDLNKTATELSDWLGLITQMLKSNIVTVGDIEEIRTTMGRLQVTKNDLEQRHHQLED
IFTLAQNIKNKTSNLDVRTSITEKLERVRSQWDGTQHGVEARLQQLDNMIGHSSRWEEQR
KEVKALIGHHEGRFHNLLQQSRDPLTKQLADNKALLQDLGRGQAAVAGFNELSAHLLHEY
SADDTRRIKEVTDKHNAVWSSINNRATDRHAHLDSELKGLQMSLRELETFLKWLQEAETT
VNVLADASQREDLSQDTAHVKELRRQLEDIQAEIDAHNDIYKSVDGNKSKMVKALGSSEE
AAFLQHRLDDMNQRWNDLKAKSANIRAHLEASAERWSRLLGLLEELWRWICMKDEDLAKQ
MPVGGDVPTLLQQQNYCTALRSELKEREHLVVSTLDQARMFLADQPIEGPGEPRKTPQPK
TDLTPEEKARGLARAIRKQTGEVRERWERLKGHIGGWQSQVDQALERLQELQSSMDQLDL
RLTQAEEAKAAWQPVGDLLIDALQDHIDKTVAFREEIAPLRQDVRVVNELSAELTPLDIQ
LSSTAARQLDQLNMRWKLLQVAVEDRLKLLQEAHRDFGPSSQHFLSTSVQLPWQRAVSQN
KVPYYINHQTQTTCWDHPKMTELYQTLADLNNVRFSAYRTAMKIRRLQKALCLDLLDLNV
AQNTFKQHKLANNSQLLSVPDIINCLTSIYDGLEQEHKDLVNVPLCVDMCLNWLLNVYDT
GRSGKIRVLSMKIGLLSLCKGHLEEKYKYLFSQVASAGDTCDQRQLGLLLHEAIQIPRQL
GEVAAFGGSNIEPSVRSCFQHMNNKVELEPRQFVDWMRLEPQSMVWLPVLHRVAAAETAK
HQAKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLNYPMVEYCTPTTSGED
MRDFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNMETPVTLISMCPEQYELAQMERS
NGSLPTDSSSATGSMDDEHTLILQYCQTLGGESSPCSQPQSPAQILQAVEREERGELERI
IARLEEEQRNLQREYEQLQEQHGQRGAPPEGQWESETSFSHPDEADLLAEAKLLRQHKGR
LEARMHILEEHNKQLESQLHRLRQLLHQPDMDSRVNGVSSPTVHDGRLLAETSVCLQKEN
PCVCLCVFPDELLDSHNSSSDLADVMEQINNSFPACSRKFPTSPPPPLPPPPL
Download sequence
Identical sequences H2VBV3
31033.ENSTRUP00000046695 ENSTRUP00000046695 ENSTRUP00000046695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]