SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047035 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047035
Domain Number 1 Region: 24-207
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.62e-48
Family G proteins 0.0000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047035   Gene: ENSTRUG00000018379   Transcript: ENSTRUT00000047194
Sequence length 227
Comment pep:novel scaffold:FUGU4:scaffold_78:810252:816261:1 gene:ENSTRUG00000018379 transcript:ENSTRUT00000047194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGGGGGGGGGELVNMAGGSVSECKEYLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATI
GVDFALKVINWDSKTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDVTRGSTFEAVS
KWKHDLDSKVKLANGSPIPSVLLANKCDQKKESFNSKVLMDSFCKETGFLGWFETSAKDN
INVDEAAHFLVDNILANDKGLPYEESNGDRIKLDQETVAAESKPGCC
Download sequence
Identical sequences H2VCU2
ENSTRUP00000047035 31033.ENSTRUP00000047035 ENSTRUP00000047035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]