SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000047771 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000047771
Domain Number 1 Region: 34-370
Classification Level Classification E-value
Superfamily L domain-like 2.38e-67
Family Internalin LRR domain 0.031
Further Details:      
 
Domain Number 2 Region: 391-529,590-619
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000103
Family G proteins 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000047771
Domain Number - Region: 645-707
Classification Level Classification E-value
Superfamily Polo-box domain 0.000177
Family Swapped Polo-box domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000047771   Gene: ENSTRUG00000018650   Transcript: ENSTRUT00000047933
Sequence length 1007
Comment pep:novel scaffold:FUGU4:scaffold_27:1679333:1691859:-1 gene:ENSTRUG00000018650 transcript:ENSTRUT00000047933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMEDKENKLKTVRLWRDAALRSRKLRSNLRQLTLCSKDDQIVLPEDIAEIELLNLGNNS
LHELPDGLGSTLNNLRILVLRRNRFTAVPRAVFELGQLVELDMSHNCLRSLSEDVGQLKG
LKKLCISHNKIQHLPLQIAALQLLEELDISFNDLHDIPRFFSSLVNLRTLDADHNKLNQF
PPEILALGSLEELDCSGNKFESLPADIMKLKFLKILWLSSLHIPILPDTFCQLQNLESLM
LDGNNLSALPVNFGQLQSLKMLNLSSNKFESFPDVILSITGLEELYLSRNKLSHIPEEIG
HLEKLDNLWLDNNNITYLPDSIVDLEMLEELVLQGNQIAILPDNFGKLSRVNIWKVKDNP
LIQPPYEVCMKGIPYIAAYQKELANSQLAVKPRLKLVLMGTKSAGKSQLRQSLVSTQQDP
KRIQGNKGIEVTNWVADTDSQLTFLVYDLSGKQNYDLIKPFFLSAGALYTLVVNLKAYSP
RNFYAHVGYFLHLLNAKVPHAVVCLVGTHTDLCAEEEVEEKTLDIHRQIGLQEQRDIQSL
KSLALLVDQALEQGYSVRSSSPHVLFYGVSDRNLRRRKSQLQYMLNHRLQILSPLLGVSC
TETQRNIQRLKEKLMSMVENREIFPNLHRVLPKSWQMLEELHFKSKDLWLSWWDSARLGL
QSGLTEDRLQSALSYLHESGKLLYFEDSLTLKDYVFHNLPRFIEILNVFFQRDESTLLDR
LLSEGERGDKGRVSLVIEDEKGENLRVTHLQHLVEGFLQQGLLPSNIIRLLLRPLIQTQQ
DLHLIMELLEKMGICYCINKPRSKPLNGSTAWYKFPSYISNDEPEVEASSAGSLPLCHFF
SVEQLHIQYSFPFLFPPGLFARFSVQINSHVVQRSDGRYQIFAYRGKVPVVISHMPSKGK
LQAETLSIASQASLPNIWTAWQAITPLVEELNTLLQEWPGLYYTVQILCSKCLKRGSTSP
HAFPGELLSQPRPEGLTEIVCPKNGSERVNVALVYPPMPTALSPSPK
Download sequence
Identical sequences H2VEX6
ENSTRUP00000047771 31033.ENSTRUP00000047771 ENSTRUP00000047771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]