SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340622237|ref|YP_004740689.1| from Capnocytophaga canimorsus Cc5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340622237|ref|YP_004740689.1|
Domain Number 1 Region: 149-325
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 2.24e-37
Family Endonuclease I 0.001
Further Details:      
 
Domain Number 2 Region: 34-106
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000131
Family Fibronectin type III 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340622237|ref|YP_004740689.1|
Sequence length 342
Comment extracellular ribonuclease [Capnocytophaga canimorsus Cc5]
Sequence
MKNIFYFIVIFVIACNSNEQQNNRAPESFRIENTIVNQEVATISWSQSVDPDGDNVQYII
ELEGKNIATINRLNYTFTHLTQNKTYQGFVTATDGKGGNTKVDFSFTTSSNGNTSTSFNI
PSELKSYYKDVDFSKRNQELRDVLATLTIGKHATFLKYPERHAYLYKADRSQDNENQVVL
LYTGEKRYWKEYEGSNYHPQTFNTEHVYPRSKIESTAQADLHHLRACDTKVNSNRGNLPF
TQGQGQARQIGGGWYPGDEWKGDVARMVLYLNIRYNENMGSDISTGSIELLLKWNAEDPV
SYIEKNRNNVIEAAQGNRNPFIDNPYLATLIWGEKSAENRWK
Download sequence
Identical sequences F9YQX2
WP_013997569.1.55458 gi|340622237|ref|YP_004740689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]