SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000000405 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000000405
Domain Number 1 Region: 400-663
Classification Level Classification E-value
Superfamily YWTD domain 1.26e-55
Family YWTD domain 0.0000000829
Further Details:      
 
Domain Number 2 Region: 316-393,663-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000155
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 196-233
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000262
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 4 Region: 21-59
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000393
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 106-141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000707
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 232-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000694
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 7 Region: 144-180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00062
Further Details:      
 
Domain Number 8 Region: 62-100
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000969
Family LDL receptor-like module 0.00068
Further Details:      
 
Domain Number 9 Region: 276-314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000122
Family LDL receptor-like module 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000000405   Gene: ENSTRUG00000000187   Transcript: ENSTRUT00000000408
Sequence length 895
Comment pep:novel scaffold:FUGU4:scaffold_166:13590:39768:-1 gene:ENSTRUG00000000187 transcript:ENSTRUT00000000408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALRPLTCPLLPLSVPPCPAKKTCAPAEFACLNGQCVPGRWRCDGEPECPDGSDEAAETCS
IQTCPPEKFDCGGSTNKCVSLSWRCDGEKDCENGADEEDCASDAKACPSGEFMCGNRKCL
ASTYVCDGDDDCGDGSDELKCASPLTCGPDHLRCNTSECVPLMWSCDGDPDCSDSSDEGP
ERCGGDGAPYLLNRRANCSAGEFRCANGECVRLTWKCDGDPDCKDKSDESDCPLLTCRPD
EFQCGDGSCIHGTKQCNKVHDCVDHSDESGCVNATRCEGPLKFLCKNGECIDSSKVCDSV
KDCKDRSDEPKKECGLNECMINNGGCSHVCMDRPIGFECQCPPGYRLLDRKTCGDIDECE
NPDACSQICINYKGDFKCECYEGYEMDPVTKTCKAEGKSPYLLFTNRHEIRRIDLVKRDY
SQVVSTQKNAVALDLDVANNRVFWCDRFHRKIYSAFIHEASDPSQQVPLLESHLHTPVGL
ALDWLQHNLYWTDSGDKSISVASADATKRRVLISTDLSEPRSIALDPHHGFMYWSDWGTR
AKIEKAGMNGVDRQVLVADSIEWPNGITLDVANRRLYWVDSKLHLIASVDLNGAHRRTHM
SSAETLGHPYALAVFEDRIYWTDRDRAAVFMANRLSGQDIHTLAENLNDPHDIVVFHQLR
QPQGPDSCNLGSMANGGCEYLCLKAPQITEHSPKYTCACPNGQDLGPDMRGCVPARANVP
DNVAPPSGQASQADATSHLTTAPSGAPEVLTPLSTPKPVSSQESKALGSTATTTVVSTTP
GGDSSVSQHCFPPSISHSSSLTLCSNLTPDFSLSLSLSLTLQSSVSKLKVAQLQNAETHA
VPIVATVVFGLVCAGVYLVWRNWRRNSTKSMNFDNPVYRKTTGEGEEDEIHIGRT
Download sequence
Identical sequences H2RJU2
ENSTRUP00000000405 31033.ENSTRUP00000000405 ENSTRUP00000000405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]