SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000001547 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000001547
Domain Number 1 Region: 289-413
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-22
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 2 Region: 417-456
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000275
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000001547   Gene: ENSTRUG00000000648   Transcript: ENSTRUT00000001555
Sequence length 483
Comment pep:novel scaffold:FUGU4:scaffold_307:131095:135969:-1 gene:ENSTRUG00000000648 transcript:ENSTRUT00000001555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEDPTETSDALLVLEGLGSGEGGEDEEGGSSEKGPQTGRGGGGLHRSELPLTSGHIRRCH
VPPPVCGLSPPHQSTCSPPQLQQPPPFFKCPHPSRPPRGKSRKGGSLKVRLSKLFRTKSS
SGGSGGLLDKRPSLASSTSSGGSLLDVWGSTCSSGEQDSSRPSPDLHQTFTRPSPDLGLV
VLSSETVSLVDVDISRRSGTSFHPPTPPPPPRRSLSLLGTSSSFFSVITSFAAPPNTGPQ
PLPQHHPAQPEPQRGLPRPVPLRPNAQHPPPRLAPRCPLSRPENGSFATSLRELEKCGWY
WGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSFRSQRSQGVTHHTSMEHYRGTFSL
WCHPKFEDRCHSVVEFIERAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSSVKSL
QHLCRFCIRQLVRIDHIQELPLPTPLISYLRKFYYYDPEEEIHPSLTEQGAEPSAQLVIQ
PQT
Download sequence
Identical sequences H2RN34
31033.ENSTRUP00000001547 ENSTRUP00000001547 ENSTRUP00000001547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]