SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005192 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005192
Domain Number 1 Region: 45-516
Classification Level Classification E-value
Superfamily Sema domain 2.22e-128
Family Sema domain 0.0000266
Further Details:      
 
Domain Number 2 Region: 1356-1486,1704-1893
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 962-1051
Classification Level Classification E-value
Superfamily E set domains 2.22e-17
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 4 Region: 866-961
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000154
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 5 Region: 519-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000144
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 1049-1153
Classification Level Classification E-value
Superfamily E set domains 0.0000000000103
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 7 Region: 815-850
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000288
Family Plexin repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 1156-1231
Classification Level Classification E-value
Superfamily E set domains 0.0000108
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005192   Gene: ENSTRUG00000002260   Transcript: ENSTRUT00000005223
Sequence length 1923
Comment pep:novel scaffold:FUGU4:scaffold_325:109502:216598:1 gene:ENSTRUG00000002260 transcript:ENSTRUT00000005223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STAKRQQVLPFISLNFLCIFPARTLIMESWRSTPIPAPSNGQTFTSFHPERRDWVFNHLT
VHQTTGALYIGAVNHVYKLSGNLTLLVSHDTGPEDDNKACYPPLIVQPCTEPLVSTNNVN
KLLLIDYSQNRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMYGVIVP
SQGQDGTLFIGTAVDGKQDYFPTISSRKLPRDPESSAMLDYELHTDFVSSLIKIPSDTLA
LVSHFDIYYIYGFASGSFVYFLTVQPETPENSMASSGSTSDLFYTSRIVRLCKDDRKFHS
YVSLPVGCVKNGVEYRLLQAAYLGKPGRVLANSLNISTQDDVLFTIFSKGQKQFHRPPDD
SALCVFTIRHINARIKERLQSCYQGEGNLELHWLLGKDVQCTKAPVPIDDSFCGLDINQP
LGGSQLVTGHALYTETRDRMTSVTSYVYNGYCVAFVGTKSGRLKKIRVDGPPHGGVQYET
MSVIKDGSPVLRDMAFSLDRNYLYVMSERQVTQVPIESCEQYGTCGECLSSGDPHCGWCV
LHNICSQRSRCERAEEPYRFAASLNQCVKVSVYPDSIAVSEPSVPLLLKVSHVPDLSAGI
TCSFGNLTEVEGQVNGNQILCVSPAAKDVPLIPTDQDWSGVELRLNSKETGQMVISTEVK
FYNCSVHQLCLSCVNSAFRCHWCKYRNLCTHDPSSCSFQEGRVNASEDCPQLVRSEEILI
PAGEVKPITLKAKNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGM
KISELPVDFSVVWNGNFIIDNPENIQVHLYKCAAQRDSCGMCLKAERKFQCGWCSGEGRC
TLRHHCPPINPYTSHWLNLSSKNVKCTNPRITEVTPVAGPPEGGTRVTIHGTNLGLAFSD
MVGNVEVAGVRCTPVEDGYIIAEQIVCEMDPAPLDIRPGPVQLCVGECRPELRARSLQLY
SFVTPTVTGLSPSRGPESGGTKVTIMGENLGAGSAVTVLFGNQTCEFFGRTMTEIVCYSA
PSLSGVGPVQISVSVDRAQIRESLTFDYIEDPTVQRIDPDWSIASGHTPLLVTGTNLDVV
QEPRIRVKYAGRESVNVCKVLNMTSMSCFAPSLMVEYHPGLDTVKHADEFGFIFNNVQAL
LVYNNTNLLYYPNPYFEPLSSSGVLEQKPGSPIILKGRNLVPPAPGGVRLNYTVLIGETP
CSVTVSESQLLCEPPNLTGQYKVMVQVGGLHISPGAVHIMSDSLLTLPAIVSIAAGGGLL
LIIVILVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDR
AGIPYLDYRTYAMRVLFPGIDDHPVLRELEVRRNVEKALKVFGQLINNKVFLLTFIRTLE
MQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDRNLASKNHPKLLLRRTESV
AEKMLTNWFAFLLHKFLKDCAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQ
QIEYKTLLLPCSEEPIMRPHSPSCCLFPQILNCVNPDNENSPEIPVKVLNCDTITQVKEK
ILDAVYKNMPYSQRPRAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLLHYQVSD
RCVVALVPKQTSSYNIPSSASMSRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKV
WHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSTLPL
AIKYMFDFLDEQADRHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACL
SVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKSWVERYYADINRLPAISDQDMNA
YLAEQARLHSTEFNMLSALNEIYSYISKYSEEITMALEQEEQARKQRLSYKVEQLISAMS
FES
Download sequence
Identical sequences H2RYH1
31033.ENSTRUP00000005192 ENSTRUP00000005192 ENSTRUP00000005192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]