SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000005238 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000005238
Domain Number 1 Region: 18-255
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.04e-57
Family Ankyrin repeat 0.000096
Further Details:      
 
Domain Number 2 Region: 269-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000314
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000005238   Gene: ENSTRUG00000002275   Transcript: ENSTRUT00000005269
Sequence length 318
Comment pep:novel scaffold:FUGU4:scaffold_620:20469:23036:-1 gene:ENSTRUG00000002275 transcript:ENSTRUT00000005269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNHHCRRNPELHEELQIQAAVAAGDVYTVRRMLEQGYSPKIRDANGWTLLHFSAAKGKE
RCVRVFLEHGADPTVKDFIGGFTALHYAAMHGRARIARLMLESEHRRDIINAKSNDGWTP
LHVAAHYGRDSFVRLLLEFRAEVDPLSDKGTTPLQLAIIRERSSCVRILLDHSANIDIQN
GFLLRYAVIKGNHSYCRMFLQRGADTNLGRLEDGQTPLHLSALRDDALCAQMLYAYGADT
NTRNYEGQTPVALSVSMSGISRPCLDFLQEVTRQPRTLQDFCRIKIRHCIGLQSLKSLED
LPIAKVMIDYLKHKFDHL
Download sequence
Identical sequences H2RYL7
31033.ENSTRUP00000005238 ENSTRUP00000005238 ENSTRUP00000005238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]