SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000006105 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000006105
Domain Number 1 Region: 24-205
Classification Level Classification E-value
Superfamily vWA-like 1.23e-41
Family Integrin A (or I) domain 0.00059
Further Details:      
 
Domain Number 2 Region: 1382-1579
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.49e-33
Family Pentraxin (pentaxin) 0.00072
Further Details:      
 
Domain Number 3 Region: 2103-2172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.81e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 2710-2776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.07e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1921-1988
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.45e-17
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 2827-2889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-16
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 3182-3246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.72e-16
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 8 Region: 2884-2950
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.63e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 9 Region: 2653-2715
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000128
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 10 Region: 2161-2227
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000473
Family Complement control module/SCR domain 0.00066
Further Details:      
 
Domain Number 11 Region: 1862-1929
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000499
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 12 Region: 2768-2837
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000005
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 13 Region: 2222-2287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 1641-1704
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000011
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 2338-2409
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2515-2581
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000148
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 17 Region: 1746-1811
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 18 Region: 2398-2467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000361
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 19 Region: 1587-1652
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 20 Region: 2456-2519
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000944
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 21 Region: 1805-1869
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000764
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 22 Region: 383-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 23 Region: 322-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000208
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 24 Region: 2611-2663
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000667
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 25 Region: 3004-3065
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000702
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 26 Region: 1977-2045
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 27 Region: 1257-1375
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.0093
Further Details:      
 
Domain Number 28 Region: 3058-3128
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000459
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 29 Region: 2939-3000
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 2280-2349
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000108
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 31 Region: 2042-2109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 32 Region: 3249-3305
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000153
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 33 Region: 1148-1267
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000424
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 34 Region: 941-1085
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000105
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 35 Region: 3121-3188
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000208
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 36 Region: 437-498
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000025
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number 37 Region: 3293-3357
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000025
Family Complement control module/SCR domain 0.0049
Further Details:      
 
Domain Number 38 Region: 1698-1743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000174
Family EGF-type module 0.023
Further Details:      
 
Domain Number 39 Region: 671-724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000082
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000006105
Domain Number - Region: 223-371
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000162
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 3483-3512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000329
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 3453-3481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000643
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 3414-3450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0343
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000006105   Gene: ENSTRUG00000002627   Transcript: ENSTRUT00000006143
Sequence length 3518
Comment pep:novel scaffold:FUGU4:scaffold_395:52570:100938:1 gene:ENSTRUG00000002627 transcript:ENSTRUT00000006143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESAESKVERLGQAFKQNVRKLREKSLCLDLVFLVDESSSVGANNFLSELRFIRKMLSDFP
VAPENTRVALVTFSSKTHVVTRVDHISAPKSHQHKCSLFNKEIPAINYRGGGTYTKGAFQ
RAAQILRNSRANATKVIFLITDGYSNGGDPRPVAAALRERGVEIFTLGIWQGNIKELHDM
ASQPKDQHCYLVHNFAEFEALARRALHEDLPTGSYIQEDLSLCSSLCDAGRDCCDLMASC
KCGTHTGQYDCICEKGYYGKGLQHECTACPPGTYKPEGAPGGPGTCLPCPDAQHTSQPGS
TSINDCVCKPGYQPVGMTCQMVYCPPLPPPENGHFIQNVCNNHYEAACGVRCLPEFDLQG
TSIRLCQADGTWSGTPARCTVRSCPPLSRPKKGFLRCSNSGASNRTECQVGCERGYRLEG
PSRLTCQANSLWSGPQPRCVEVRCPPITTLKNISLSPPACGKRPASPGSTCLLTCRKGFT
LLGNRKAVCLGSGNWTANIHKATCADAEPPWLQCPEDVVSGTDERRGTTNVRWTVPTATD
NSNEEVAVQVKPVYTPPQLFPIGNETITYIATDRSGNQANCSFTVTVVDTEPPVIDRCRS
PPTVQAADIETAVVWEVPQFSDNSGGRLTVTSNHSPGSWFPVGETLVQYTATDAAGNSRT
CNLTITVQGTTCEQPYIPVNGEFVCSDEEEGVNCTLHCNDGYSITQDAVHSYFCAYNGVW
EPPYSPDRPDCSVNRMANNGFKPFEMLFKASRCDELDLVEAFTGEFNTKLRGMLPNICSS
SDVTCKLEMMPQGHCLEYNYDYENGFSIGPGGWSNSGGAQGTQDYAYFESGFATGARPLA
RQQRDTAVRPHPLAKRLRRIRRPTRDQKIQIFFNITASIPLPVSRNDSVEVANQRRLLRT
LEQLTNRLKRTLARQPLSSFRVSSEMIVADPKSLEGRKAFLSCRPGSVLNGRMCVQCPVG
TYFSLEHNECASCWLGSYQDQEGQLECKSCPEGSSTAYLHSRSITECKGQCKPGTHSANG
LEICESCPLGHYQPGYAARDCLVCPEETSTVTRGAVAEAECGVPCSAGHFSRTGLVPCYP
CPRDYYQPDHGRSYCLSCPFYGTTTVVAATTIQRCSSFSSSFLPKEESVTAAPEVKVSED
YQASSQVFHECFLNPCQNKGTCEEVGAGYICTCMPGFTGAKCEVDIDECDSAPCQNGGLC
NDGMGEFQCDCKPGFIGAVCEAEVNECISFPCLNKGVCVDEVNKFTCSCAAGFTAGSRCE
LEINECLSNPCLNGGACEDQTGGYVCNCPVGFSGDHCEVDVDECYSAPCLNGGHCQDGID
SFRCRCALGYRGHLCEVNINECEPNPCVNGASCMDGLGSYTCRCLPGFNGTRCETEMSSA
FNLDFEVSGIHGYVMMDGVMPALTEITCTFWMRSTDTTNYGTPISYAVEGSDNAFLLIDY
NGWVLYVNGKERITDCPAVNTGQWYHIGVSWRSWDGDWRIYINGKPSDGGKGLSVGTTIP
GVVPGGALVLGQDQDQRGEGFNPVESFVGSISQLNIWDRVLTPQQIKVLASSCPTSHVAH
RGNVLAWPDFLAGLVGRLKVNLNSIFCADCPKLENAVSHLHTSTVEVKAGTQVRLSCDPG
FYLLGEPVLQCQNKGEWSHPLPSCERVSCGPPHPLENGWFQGTDFQAGSSVEYQCNAGFY
LLGDTKVHCANSGKWGGNSPACLDVDECALGSDCDKHARCLNTEGSYTCTCKHPYSGDGK
NCTEPVKCKDPGSPDLGHREGNNFLMGGEVVFGCGLGYELVGPPRLHCLETGNWDNPIPY
CRALSCLNPTVPENSVMSGSNFTYGSKVTFRCMKGFLPPISYEFQCMASLRWSGTPPLCH
PVTCREPPSGVNADYTFKTNTYQSRVTYTCLEGYRPQGSMEVVCEETGEWSRPVPRCVSA
LCGEPPTLRDAVTVGENYEVGSKVHYVCKEGYTLIGPEARECLASGQWSDTSTQCVPRSC
GPPPAIDHAEPYESHQLFGDTANYFCTDGYIAGNNSKMVCNAQGQWAPPDGATVPRCIAN
FCSRPPELPNAILDSVSKPKYPSSTEVSYKCEEGFMLNTTATLRCLMGGEWDPSPYHIGC
VPVRCSRPESIDRGYVSGSNYSFGAVVAYSCDKGFLIRGEKRRTCKANGEWGGVLPSCAP
VTCPLPPLLKNGYIQSRGRLTFNSKVTYACNAGFRLLGRPDRVCQANRQWSSTDPPTCVL
LTCDPPPDIVHGHYRGSDFQVGRKVQYVCDEGYELIGDANWTCLKYGKWDKLRRPRCSPV
QCPEPPLEESHLVLKGLDADSGTVELSCEDGYVLQGARTLRCTPSQEWNDTFPVCKEVFC
GPLPEVSSGGPSTPSAPFPFRSVVNYTCMEGFTLKREGSVSCLASGKWSSPVPECIPVEC
PQPVEISNGIVDVQGLMYLSKALYNCKTGYNLVGNSTVLCGEKGLWIGGVPSCRPIECSV
PKRITNGKVAFTKLQFGHSAIYSCLRGYRLQGPDTLKCLASGEWDIDPPACVQMSCTPPQ
PLENGFVEGQDHSFGVTIFYSCFPGFQLVGQDHLTCEEFGWSSSIPVCVLSDCGLPPHID
FGDYVRVTGSGSGSSAAPRDTDTAASPVNLSFFHGTLVEYRCHKGYDLTSPTRLMCQEDG
GWNGTAPSCVPAECQSPPNPDHGWVNVTDTSLGSMVKYTCEKGYVLEGEPVRQCISGRSW
THSAPTCRPVSCGDPGAIANGIAHGGSFLFSSVLRFKCSPGFALKGSEIITCQADGRWDV
QKPTCEPVVCGPPIVPSDVSFTGDEYRFNNEIELKCQLGFLIQGKSVSICQADGTWSHKS
PTCVPASCDKPSSIPNGRVLGSEFSFNNKIKYECDEGYALNGVPTRICQSDGLWDKPEPR
CDIISCDPPEDISHGFLNGSSFNYGDVVEYVCFDGYEVLGDPVLRCSAQGSWAGTVPRCK
PCICSPPTLRYGAVLGQDHACGDRVHFRCDDNYRLLGPSQAVCEKGGVWSPGVPMCGRGR
CSAAPPAVPNAVQQGGTAAFSDTVIYRCRPGYRPKGYSHLTCGRDGRWGEPRISCEAVSC
GQPPAVVHARVVGGNFTFPNQITYSSRCEDGYQLATQMSTLSCQSDGTWSKHSIRCGPLP
CLLPRNFSNPHVIITGKELTPVGGAITLSCPPGLYLQGSALAECRLGGTWAPSISSVSCE
PVVCERPPPLPQGVTEGDSYTYGDVVMYSCLPGFTMKGDSVQTCQGDRTWSGTRPVCVGR
QSHIFLTLKNAQVQMRGDADREGVSYVCGAGLQLVGPKTLSCLANGTWSAPAPTCEPKRC
PPPPGWRDDGGGSGPQAEFRVGQSVRVTCPRGQEVKGSGTITCRPDQTWSHISSVCENLG
SSVPLNMLISPLIRGSKQMFIRQSPFLLLTDLFCFALDTFLFSSILEAQTSPRLCSAICW
LQCQNGGMCQRPNICSCPEGWMGRLCEEPICILPCLNGGRCVAPYQCECPTGWTGTRCHS
AVCSSPCLNNGRCIRPNRCHCSPGWTGNDCSRKRKSGY
Download sequence
Identical sequences H2S134
ENSTRUP00000006105 31033.ENSTRUP00000006105 ENSTRUP00000006105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]