SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000007454 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000007454
Domain Number 1 Region: 31-200,364-553
Classification Level Classification E-value
Superfamily L domain-like 3.74e-47
Family Ngr ectodomain-like 0.034
Further Details:      
 
Domain Number 2 Region: 655-808
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.31e-38
Family Toll/Interleukin receptor TIR domain 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000007454   Gene: ENSTRUG00000003176   Transcript: ENSTRUT00000007500
Sequence length 815
Comment pep:novel scaffold:FUGU4:scaffold_661:10210:13813:1 gene:ENSTRUG00000003176 transcript:ENSTRUT00000007500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASETRTMFFTLLFTLSFCEGQGSIVKVDRPSCDRCDHSFFCNCSFAGLTCVPVVTEQALS
LDLSFNNITVVTAEDLRDHRRLAALNLCCNRLAVIHQSAFEPLWNLEDLNLSNNQLTALN
HRWFHKLEALRVLNLLHNPYSCLGSPPAFQRLLNLRRLRFGGPALEELKRGDLAGITHLE
ELTVHANNLRRYESGALATIWPLGRVILSLHGPFLTNDDVASTMLGDVSYPETPMILRDL
NLTWIQSVHNLRVAARRRIRHLSFQNLSLSDMATVEFLVVFDGVPLTHISVEGVTLKGVG
RWEKANKTEHKGIDEIFVRDVEVLDIYKFASLISCGFLLQYPRKVSIINAKVFVMPCFTS
HLLKNLQYLDLSNNLLTDMTLAETLCDGDSPLKDLRVLNISGNALKSLSTTSRLVGKLLR
LTHLDVSRNGYSSMPLGCSWPSSLRYLNMSGTRIASISPCLPAALEVLDLSNNDLKDFVL
VLPTLRELHLSGNKLLRLPPGWFFPNLNTLTIQSNSLSMFGPSELRTYSRLQSLQAGWNK
FVCTCDFVGLFQSGVKVGSVQLTDREDDYICDAPLRLQGALVARVRLPLVHCHPVQVVSA
SCVVALLATAALGTLLWHVHAFWYLRMMWAWLKAKHSSRQRRGLDQRGGAGVEDDFDAFV
SYSNRDAGWVENFLVPELEQPRADDEAAVRARPMTLCLHKRDFLPGHWILDNIMSAMERS
RRTIFVLSENFIRSDWCRYELDFSHFRLFDGVAGEPAILILLEPLNKDDIPRRFCKLRKL
LSSTTYLEWPHGEEKVGEFWKALRTALRGEEEWEE
Download sequence
Identical sequences H2S4Y2
31033.ENSTRUP00000007454 ENSTRUP00000007454 ENSTRUP00000007454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]