SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000008388 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000008388
Domain Number 1 Region: 38-502
Classification Level Classification E-value
Superfamily Sema domain 1.57e-130
Family Sema domain 0.0000134
Further Details:      
 
Domain Number 2 Region: 1344-1473,1687-1875
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.18e-50
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 1037-1140
Classification Level Classification E-value
Superfamily E set domains 2.15e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.077
Further Details:      
 
Domain Number 4 Region: 950-1039
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000624
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 
Domain Number 5 Region: 852-951
Classification Level Classification E-value
Superfamily E set domains 0.00000000000159
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 505-556
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000196
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 1156-1228
Classification Level Classification E-value
Superfamily E set domains 0.00000812
Family E-set domains of sugar-utilizing enzymes 0.046
Further Details:      
 
Domain Number 8 Region: 806-838
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000235
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000008388   Gene: ENSTRUG00000003572   Transcript: ENSTRUT00000008438
Sequence length 1906
Comment pep:novel scaffold:FUGU4:scaffold_318:49520:147612:-1 gene:ENSTRUG00000003572 transcript:ENSTRUT00000008438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLLSSSLSLDYFLFLDRIVLIVTLSSSEGQPTRFKRFAPAEWGLTHLAIHNKTGEVYVGA
VNWIFKLSNNLTKLRSHMTGPVVDNEKCYPPPSVQSCPYDLAQTPNVNKLLLIDYAQNRL
IACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAESGTMSGVIISSPHSPTSKLFIG
TPIDGKSEYFPTLSSRKLMENEENADMFSFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVY
SFSSEQFVYYLTMQLDTQLTSPDASGEQFFTSKIVRLCVDDPKFYSYVEFPIGCTKDGVE
YRLVQDAFLARPGRQLASSLGISENEDILFTIFSQGQKNRAKPPKESALCLFTLRKIKEK
IKERIQSCYKGEGKLSLPWLLNKELACINSPLQIDDNFCGQDFNQPLGGTSTIEGIPLFI
DKDDGMTSVAAYDYRSNTVAFVGTRNGKLKKILVNSSNRPAVIYEKVTVSEEGGPLLRDM
LFSPDQQHIYALTEKQVVRVPVESCEQYATCGECLGSRDPHCGWCVLHNVCSRKDRCERA
GEPQRFASDQRQCVELTVQPRNISVTMSEVQLFLYLHRLCTCFMCQTANFDFDTQSRGNM
SDILLQRYVSSPQLSPLCPITTAHRDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCL
SCVNGSFPCHWCKYRHVCTQNANDCSFQEGRVNVSEDCPQILPSTQIYIPVGVTKPITLA
AKNLPQPQSGQRNYECVFHIQGETHNVPALRFNSTSIQCQKTAYMYEGNDISDLPVDLSV
VWNGMFVIDNPYNIKAHLYKCYALRDSCGMCLKANPRFECGWCVQEKKCSLRQECTPPES
TWMHATTGNSRCAHPKIIKLHPETGPRQGGTMLTITGENLGLQFKDIQNGVRIGKVACIP
QEDQYISAEQIVCQLNDATGYRVQEAQVEVCVRDCIHQDYKAVSTKAFTFVSPYFNRVQP
STGPLSGGTRITIEGSHLNAGSAVFVKIGLHPCRFERGSSKEIVCVTPAGQAPGTTPVMV
DINSAELRNPEVKFNYTDDPTILKIEPDWSIASGGTMLTITGTNLATIKEPKMRAKYGAV
KSENNCTVVNNTVMVCLAPSVAGSDKSFSEAGSSPDEIGFVMDNVVAVLVVNETFSYHPD
PVFEPLSSTGLLELKPSSPLILKGRNLIPSAPGNTKLNYTVLIGETPCVLTLSETQLLCE
WPNLTGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIIVLIAYKR
KSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLEYRTYAM
RVLFPGIEDHPVLKEIEVPANVEKALTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNV
ASLIMTALQGEMEYATAVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLL
YKFLKECAGEPLFMLYCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDYKTLDPVADK
WKSCDGSITIHLQTLHCVNPENENAPEVTVKTLNCDTVTQVKEKLLDAVYKGTPYSQRPK
ASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYNI
SNSSTITKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHPDQREGDR
GSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHS
ISDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHK
LGKDSPSNKLLYAKDIPNYKNWVERYYSDISRMSAISDQDMSAYLAEQSRLHVNQFNSMS
ALHEIYSYIVKYKDEILSALERDEQARRQRLRSKLEQVIDTMALAS
Download sequence
Identical sequences H2S7L6
31033.ENSTRUP00000008388 ENSTRUP00000008388 ENSTRUP00000008388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]