SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000010831 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000010831
Domain Number 1 Region: 87-265
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.04e-41
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 4-71
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000111
Family WWE domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000010831   Gene: ENSTRUG00000004556   Transcript: ENSTRUT00000010889
Sequence length 265
Comment pep:novel scaffold:FUGU4:scaffold_197:90752:91792:-1 gene:ENSTRUG00000004556 transcript:ENSTRUT00000010889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AESMAAWQYQQGNGFQNFDSTANYELEEALLNNVSSVDITIQGQLYTVQMPSGPATDKQG
NSLQIRRADKDEDTPNHWDVMPANTSCHTVTLAAGSEEYKQVERKFQATCGQTIISIERI
QNPLLWKTLQIKKRNMEQKNGHQNNERILFHGTSEETIATINANGFNRSYAGKNAAHYGN
GTYFAVNAKYSAQDLYSKPNQNGDKHMYLCRVLTGDHTLGQKGMVAPPQKTSNSVELFDS
AVDNQANPHIFVIFSDNQAYPEYLI
Download sequence
Identical sequences H2SEK0
31033.ENSTRUP00000010831 ENSTRUP00000010831 ENSTRUP00000010831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]