SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011544 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011544
Domain Number 1 Region: 9-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.64e-62
Family Ankyrin repeat 0.0000349
Further Details:      
 
Domain Number 2 Region: 459-511
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000301
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011544   Gene: ENSTRUG00000004831   Transcript: ENSTRUT00000011604
Sequence length 520
Comment pep:novel scaffold:FUGU4:scaffold_565:3490:6622:-1 gene:ENSTRUG00000004831 transcript:ENSTRUT00000011604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRRGELLQVDARGWTPLHEAAAQTNLNILELVFAASGPGGVQRRTPPGHTPLFVAAERG
LMENAAFLLQHGADPDSQDQVLDSPLVAAIRSDRLDLVELLLLQGATVEQEGAHGRRPLH
EAARLGKAGAVTLLLEAGAHPDPRSHYGLTPLALAAQGGHREVVQALLERGAAGADALSQ
ARDEASVLYEASAAGDAAVIGLLLERGADANVANNTGHMPVHRAAHRGHLRALELLIRVT
SKAEVSESGMSPLHSAAAGGHPRCLKVLLDAGYDPNDMLHPWVRRSYSDERKSALFFAVS
NNDVTSTRLLLEGGAMTNQDPVKCLQVALRLGNYELMELLLRFGANVNYYCRVNTTHFPS
ALQYALKDQVVLRMLCQYGYDVHRCFDCPYGNSAHVPEGYEGWSDSVIKDTLFCEVITVS
WLKHLSGQVVRVLLDYVDHVPLCSKLKGAVMEQPQWPDICRLQRTPVALKHLCRLRIRRC
LGRLRLRSPVFMSFLPLPGRLKDYLLYREYDIFGAETRLP
Download sequence
Identical sequences H2SGL2
ENSTRUP00000011544 31033.ENSTRUP00000011544 ENSTRUP00000011544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]