SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000011664 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000011664
Domain Number 1 Region: 139-384
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.39e-58
Family WD40-repeat 0.00021
Further Details:      
 
Domain Number 2 Region: 380-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000131
Family SOCS box-like 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000011664
Domain Number - Region: 37-119
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.0942
Family DPP6 N-terminal domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000011664   Gene: ENSTRUG00000004887   Transcript: ENSTRUT00000011724
Sequence length 427
Comment pep:known scaffold:FUGU4:scaffold_436:85067:89711:-1 gene:ENSTRUG00000004887 transcript:ENSTRUT00000011724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPESVNENDIDKAKFIGELLVPMAPFDQKAGREAWTVAFAPDGSYFAWSQGHRIVRL
IPWAKCLSSFSVRHGGEVTNPTSPRHLSRQSCKGGSVIPMAGAPPEHTIDCGGIVWGMAF
GSSVPEKQSRCINIEWHHFQFGRDQLLLATGLNNGRIKIWDVYTGTLLLNLMDHTDIVRD
LTFAPDGSLMLVSASTDKTLRVWDLKDDGNMVKVLWGHPNRVYSSAFSPDSSVLCSVGAS
KAVLLWNMDKYTLIRKLEGHHNDVVSCEFSPDGALLATASYDTRVIVWDHQRGSILLELG
HLFPPPSPIFAGGANDRWVRSVSFCADGRHIASVSDDRLVRFWSIEERAPQAVASLPNGL
CCAFSTTGSVLAAGTCDGSVHFWECPRSIASLQHLCRMALRRVKTTQQVEALPVPMPLRD
FLTYRVV
Download sequence
Identical sequences H2SGY2
ENSTRUP00000011664 31033.ENSTRUP00000011664 ENSTRUP00000011664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]