SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012392 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012392
Domain Number 1 Region: 975-1266
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-80
Family Protein kinases, catalytic subunit 0.000000000226
Further Details:      
 
Domain Number 2 Region: 329-489
Classification Level Classification E-value
Superfamily L domain-like 2.38e-48
Family L domain 0.00000371
Further Details:      
 
Domain Number 3 Region: 33-194
Classification Level Classification E-value
Superfamily L domain-like 1.45e-40
Family L domain 0.00000164
Further Details:      
 
Domain Number 4 Region: 485-604
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-26
Family Fibronectin type III 0.0000262
Further Details:      
 
Domain Number 5 Region: 785-929
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-19
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 6 Region: 607-686,791-810
Classification Level Classification E-value
Superfamily Fibronectin type III 1e-18
Family Fibronectin type III 0.00053
Further Details:      
 
Domain Number 7 Region: 179-331
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000722
Family Growth factor receptor domain 0.00000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012392   Gene: ENSTRUG00000005173   Transcript: ENSTRUT00000012452
Sequence length 1424
Comment pep:novel scaffold:FUGU4:scaffold_225:66438:121134:1 gene:ENSTRUG00000005173 transcript:ENSTRUT00000012452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPGAPIGSPTLFWGLTLSVFTICILSACGEICSPGFDIRNDISELNRLENCTVVEGFLQ
ILLMNDKTKNINQELFRSLSFPKLTVITEYLLLFRVSGLDSLSTLFPSLTVIRGRNLFYN
YALVIYEMPNLKDIGLYNLRNITRGAMRIEKNSELCYLDSVDWSLIMNAEFNNIINLNKK
PKECDNVCPGIMVKDKPLCQRTSFNDNHEARCWTSNHCQKVCPERCKLACTDQGECCHSQ
CLGSCTEPHNDMACSACLHYHHEGRCVQDCPPGTYKFEGWRCITMDLCSQVHLLDDTQFV
LHGGECMPECPSGFTRNETNPMFCNACNGPCDKSCPSSMIDSVDAAQSLKGCTVIDGNLD
INIRHGNNITSELESFMGLIQRVTGYVKIRHSHALVSLSFLKSLRFINGHKLIDNIYAFS
AINNQNLQNLWDWNQHNLAILNGRLFFRLNPKLCISEIHKMWEKTGKTEKPEEGDFLNNG
EQASCKSHILKFKSNVTSSHTIGLTWENYRPPGYKGMISFIVYYKESPFQNITEFDGQDG
CGSNSWHMVDVDLPQDQSIDPKITLLHLKPWTQYAIFVKVITLQLGDKHITGAKSDIIYI
RTRPSLPSMPKDPRAYANSSTQLIVKWSPPAFPNGNLTYYLVRWQRQPEDRELYQHNYCS
KKPELKIPLRISATGHMDMEESTKPTKSDLAGAGNVQCCNCPKTSEVKDREKDDRLFFKM
FENFLHNAIFLPRPPDRRRRDVFGVPNSTLFLEGGVRGNTTIGTGDNTTDSIPPIKEYPF
SEGKSTVEFLEIPHLQPFTVYRIDLHACNEEVGHCSVGAFVYSRTKPAVGADDIPGKVIY
ERSDKVEGCVLLHWSEPITPNGLILMYEVKFRPGNEPEKHKCVSRQHYLEHKGARLTNLG
PGNYSAQVRATSLAGNSSWTESLFFYVPPPKRDDGVTFYLVIIIPILATLLIAGLTTILF
FVNKKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKITMHKELGQGSFGMVYEG
IAKGVVKDEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTL
VIMELMTRGDLKSYLRSLRKENSTSQVLPPLKKMIQMAGEIADGMSYLNANKFVHRDLAA
RNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTMSDVWSF
GVVLWEIATLAEQPYQGMSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPS
FLEIISSIKEELDLSFREVSFFYSEENKPPDTEELDMEVENMENIPLDPASARQPAAAAA
ATAAGSPLSGCTGGCTPPPSTQKLSPIQGPGTPLLGPVSPSSPGPVAPSLASPGQALDKH
SGHVSANGPVVVLRPNFEEMQPYAHMNGGRKNERALPLPQSSAC
Download sequence
Identical sequences H2SJ10
31033.ENSTRUP00000012392 ENSTRUP00000012392 ENSTRUP00000012392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]