SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012584 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012584
Domain Number 1 Region: 71-333
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.41e-51
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 420-459
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000301
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012584   Gene: ENSTRUG00000005244   Transcript: ENSTRUT00000012645
Sequence length 466
Comment pep:novel scaffold:FUGU4:scaffold_107:105296:108766:1 gene:ENSTRUG00000005244 transcript:ENSTRUT00000012645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGSFVFTPMALRSLQQDEDMLRRYECRRRLASRHLPSSYMLRKEARDRTPLGSSRALP
AAVCQDVVVQNALYTGNLEALQELFPRGSRVSLIIEPQGGDMRWVATGEGLWSLSYEQEL
TTPLHITASRGFTECLRLLLQRGADVELAPGGVAALHESCENCQPECTKLLLSHGANANA
VSEDGYMPLHYCAHPESLECAKYLLQYGAAVSGLSADEGDTPLHAAARNGLPGHTELYLR
YGASVNKLNAEGLTPLNAACSQHQELGDLQRYFKVCQTLLMAGADVHVTDQDKHSPLHMS
CKNANPDIVDLLLANGACVNNMDYGGEAPMHNILKVVCYKVSHQPERIVRALLNHGSIRV
WPGALPKVLKHCSMSPRTIEVLLNAYSRLKVTDTWTESVPPEVLQEHKEFYDSVFSLALT
PRSLQHLARCKLRDLLQGRVHKVVPKLGLPTFIKNYLLLEYRGYIH
Download sequence
Identical sequences H2SJK1
31033.ENSTRUP00000012584 ENSTRUP00000012584 ENSTRUP00000012584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]