SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000012810 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000012810
Domain Number 1 Region: 63-340
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-52
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.073
Further Details:      
 
Domain Number 2 Region: 880-1098
Classification Level Classification E-value
Superfamily RNI-like 8.63e-27
Family 28-residue LRR 0.085
Further Details:      
 
Domain Number 3 Region: 582-644
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000213
Family PHD domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000012810
Domain Number - Region: 498-507
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00112
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000012810   Gene: ENSTRUG00000005339   Transcript: ENSTRUT00000012871
Sequence length 1127
Comment pep:novel scaffold:FUGU4:scaffold_230:162117:172747:-1 gene:ENSTRUG00000005339 transcript:ENSTRUT00000012871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIMDDSKPRYSKRLRAGTRRHYHDDGISDEEIDGRRTFDLEEKVSSQRFRSDLVNHMEGK
DFTYEFIQRNGLREPIIFEKPDGLGIKMPDPDFNVNDVKMFVGSRRMIDVMDVSTQKGTE
MSMAQWTRYYETPLSQREKLYNVISLEFSHTKLENLVRRPTTVDLIDWVDNMWPRHLKER
QRDSTNSITDMQYPKVQKYCLMSVEGCYTDFHIDFGGTSVWYHILRGSKIFWLIPPTPQN
LELYENWVLSGKQGDVFLGDRVSDCQRIELKQGYTFIIPSGWIHAVYTPVDSMVFGGNFL
HSFNIPTQLNICNIEDRTRVPTKFRYPFYYEMCWYVLERYVFSLTKTSYLTPEFQKHSLG
IGMEIRRQFICKGYFYCVILGLKKPSNLAIEKGIVDDEESSEGEEEEEEEEEQEELSDKP
AVKVHLTPLELEGLWNLLGKLEDLPSNKKCIPSGIHNSQALVSHIKALLKEHANDNPKLS
YTGNPIITWPKRPSWYQPPPPPPPPPPRPKPATISIIPRPQKPASSMSVLRRRRVRCKRC
EACMRSECGECNFCRDMKKFGGPGKLKQTCVLRQCLSPGLPLSAVCEVCKEPNQEESGDT
SLTLMECSNCAQIVHPACLTVQGEGLINKDLPSCWECPKCVQGVTDHEPISSRLGKSDQK
PSQRAVLKPLYADATNYYSMPISKTTIRMLAQDKLSPRGRIWRNTLKRGMAMRESGRRGR
GVRLRGGSRMQRRGEESDESEDEEDDDDDEEMSDLNDDLLSGSYLTVTLQRPDKAKKQAG
SIVPKLEAAMGPRMPAGGSGPQRKTALSKHGPARFRPRGCHGDRGRKDFSASSSEEEESV
APSLSLLSLPSFKDVGNDSGGEKEVWVSVFTYLNRAELLACMTVCKAWYKWSCDKRLWSH
IDVSRCSPLSNQALAGIIKRQPYSLDLSWTPLAKRQLNCLLTRLPGLRELRVAGLAWSCL
SALVSPTLPCLQLLDLRWCEGIKDAQIKDLIMPPDSESSRSRLRNLVTLRLSGLDISESI
LKLLQRHMTQLERLELSHCKNITDSSVALLAAPGTNTRNNLTELTLAGCGELTDYCLSYM
KRLSSLTLLDLRGCRNVSRRACDAFIADLSHITLYCMMEEKLIQRID
Download sequence
Identical sequences H2SK77
ENSTRUP00000012810 ENSTRUP00000012810 31033.ENSTRUP00000012810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]