SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000018836 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000018836
Domain Number 1 Region: 1022-1342
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-79
Family Protein kinases, catalytic subunit 0.000000000553
Further Details:      
 
Domain Number 2 Region: 321-483
Classification Level Classification E-value
Superfamily L domain-like 1.56e-51
Family L domain 0.000000337
Further Details:      
 
Domain Number 3 Region: 1-161
Classification Level Classification E-value
Superfamily L domain-like 2.3e-45
Family L domain 0.00000102
Further Details:      
 
Domain Number 4 Region: 510-633
Classification Level Classification E-value
Superfamily Fibronectin type III 4.15e-28
Family Fibronectin type III 0.00000464
Further Details:      
 
Domain Number 5 Region: 808-951
Classification Level Classification E-value
Superfamily Fibronectin type III 1.7e-23
Family Fibronectin type III 0.0000848
Further Details:      
 
Domain Number 6 Region: 637-716,814-838
Classification Level Classification E-value
Superfamily Fibronectin type III 1.13e-21
Family Fibronectin type III 0.0000619
Further Details:      
 
Domain Number 7 Region: 218-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000141
Family Growth factor receptor domain 0.0000165
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000018836   Gene: ENSTRUG00000007600   Transcript: ENSTRUT00000018914
Sequence length 1435
Comment pep:novel scaffold:FUGU4:scaffold_90:208342:233731:-1 gene:ENSTRUG00000007600 transcript:ENSTRUT00000018914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCSSKDIRNSATNLQALENCTVIEGHLKILLIFGTKPEDFRGLSFPKLVVVTDYLLLFRV
YGLESLSDLFPNLTVIRGTNLFFNYALVIFEMLQLREIGLHSLMNITRGAVRIEKNPDLC
YLSTLDWSKILDSVEDNYIMANKNDRECGDVCPGASVGKTTCQTTTINGHFSERCWTQKY
CQRKTVVVGCVGLRSCPLCPSVCPVQCKHQACTKDDQCCHEQCLGGCLQPGSASHCVACR
GLQYKGTCVEKCPRNFFTYKGWRCVSFSFCYDLHNKCKREKERRNAECHEYVIHKGACIP
ECPSGYTTVNSFTLNCTPCAGLCPKVCMGLKMVDSVTAAQDLRGCTVLNGSLVINLRGGN
NIAAELEASLGQLEEITGYLTVRRSYALVSLSFFRKLRLIRGEEQEIGNYSFYALDNQNL
RQLWDWSKHNLTILQGRMFFHYNSKLCMSEIHKMEEVTGTKQRQVKNDIASKTNGDQASC
KNPGSGDPTAVENVSTTTVHRDDCLSLGETHVLKFTQVRTMSDKIMVKWEAFWPQDYRDL
LGFMVLYKEARPYQNVTEFDGQDACGSNSWVIADVEPPHRSTEVDKGKIEPGYLILPLKP
WTQYAVMVKTQLSASDENQVHGAKSEIIYIRTNATKPSVPLDPISSSNSSSQIILKWKPP
NDPNGNITHYLVFCQRQSEASELYKFDYCQKGMKLPSRVPTQVDSDEEQKWNQTEEQGQR
TRCCACPKTDKELKKEKEDSEYRKTFENYLHNEVFEINFFRRLRQRRSIAGIANQTRSLL
TTALSPPHGTDNPEGDDVFEGKTVVTIPAKESTVISGLRHFTSYQIEIHACNHPTDSSRC
SMAAYVSGRTLPEDKADDIRGPIKYDVTENSVHISWQEPAAPNGMIILYEVNYKRHGDTE
ELHYCVSRNMYKVNRGCKLKVMHPGNYTVRIRATSLAGNGSWTEPTYFYVQDPSDPLYIV
KIIIGPIICFVLLLLVAVGGFVMFKKSQTQGPSGPIYASSNPEYLSANDGEQTLVCIHTG
ISDVPAVYEEDEWEVPRDKISILRELGQGTFGMVYEGIAKDIVKGEGESHVAVKTVNESA
NLRQRIEFLNEASVMKAFSCHHVVRLMGVVSKGQPTLVVMELMTNGDLKSYLRSLRPDAE
VHERQTSPLCPICTFTVLPRLFFYTEKVTTLQILQNNPGRPPPTLKEMIQMAAEIADGMA
YLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESL
KDGVFTAHSDCWSFGVVLWEISTLSEQPYQGLSNEQVLKFVMDGGFLDRPDNCPDKMYNL
MQMCWQYNPKMRPTFLEIIEMLHDNLHPTFQDVSFFYSEENKPPESEDFDLDMENMESIP
LDPSSYSQREQCLDRDETISMGLRGSYEEHHMSFTHMNGGKTNGRILALPRSSPS
Download sequence
Identical sequences H2T2E8
ENSTRUP00000018836 ENSTRUP00000018836 31033.ENSTRUP00000018836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]