SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020168 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020168
Domain Number 1 Region: 32-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-63
Family SPRY domain 0.0000000189
Further Details:      
 
Domain Number 2 Region: 235-272
Classification Level Classification E-value
Superfamily SOCS box-like 0.000023
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020168   Gene: ENSTRUG00000008088   Transcript: ENSTRUT00000020252
Sequence length 273
Comment pep:novel scaffold:FUGU4:scaffold_20:251020:252125:-1 gene:ENSTRUG00000008088 transcript:ENSTRUT00000020252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKVPGGIKTIDMRDPAFSPLKQELQALNHTKPSRLDLLLDMPPAGPDVQVQHSWNNDD
RSLNIFVKDDNKLVFHRHPVAQSTDAIRGRVGYTRGLHVWEISWAMRQRGTHAVVGVATS
DAPLHSVGYTALVGSNAESWGWDLCRSKLHHDGKNHPGKSYPAFLESDDTFIIPDSLLVV
LDMDEGTLGYIVDGHYLGVAFRGLKGRKLYPVVSAVWGHCEIRIRYINGLDPEPLSLMDL
CRRSVRVALGRERLNEIHRLPLPASLKNYLLYQ
Download sequence
Identical sequences H2T679
ENSTRUP00000020168 ENSTRUP00000020168 XP_003963161.1.43653 XP_011620263.1.43653 31033.ENSTRUP00000020168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]