SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000020782 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000020782
Domain Number 1 Region: 315-414
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-31
Family Ras-binding domain, RBD 0.0039
Further Details:      
 
Domain Number 2 Region: 448-558
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000020782   Gene: ENSTRUG00000008306   Transcript: ENSTRUT00000020869
Sequence length 1329
Comment pep:novel scaffold:FUGU4:scaffold_32:270591:283350:-1 gene:ENSTRUG00000008306 transcript:ENSTRUT00000020869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQVSDEELDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDDGRPQKALQKPPLRQET
NMANFSYRFSMYNINEALNQGDTVDLDALMADLCSIEQELNTISKPNSTSRSHNKGQQRA
PGGHSASTKHTGASGGGSSGGGHTRPTASNISLADITSQLEKASLSMDEAARQTSSSSST
TSSSRQHRRTGSVGAVSEHEAPSQRSSVNSACASASSMDSLDIDKVPTGREVPGQSSPST
QGQNQTSTEHVTLRRTRRQLDFTPREVLSSTKHSYLDRETSLILKSIAGKPTHLLTKEEQ
AAKLKAERIRVALEKIKEAQVKKLVIRVHMSDESSKTMMVDERQTVRQVLDSLLDKSHCG
YSPDWSLVETITELQMERIFEDHENLVENLLNWTRDSHNKLMFTERIEKYALFKNPQNYL
LGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKEDGKKSWKKRYFLLRASGIYY
VPKGKAKASRDLVCFLQLDHVNVYYGQDYRSKYKAPTDYCLALKHPQIQKKSQYIKYLCC
DDVRTLHQWVNGIRIAKKYGKQLYGNYHEAMKRTEAAYDWSSLSTSSIRSGSSSVSIPGV
CTPESQSNHSGHSDSGVDTTSSQGRSQSVVSSIFSEAWKRGTQIEENTKTQTHQQHSPQT
QIIQQHPSQPPPQLQHHHPPQPVQPPTPPQPQTSPPPPPPPPPPPPPPPPAVQTVSHHSL
APTMYKYSTITRLQNQKASHHKPNHVLTKPQPVPTPPAAQVKPNVNHIAARTNVPPPPPP
PPPPSMPTPGSAMAVLRLGPPSPAAPPAFIPPPPTSAHAAQMNGGSFPPPPPPPPPAPVP
LSQSVYPPRDLLSLNGGFEESPPPAPTPTPPPPPPPPPPPPPPPPQQQQFHIPSQFPPPP
APAKPPPTLPKQHSLSKQMTSTGGPQTMSLVKQLASQFPGAPPQVNQTEIPKAPLSPPAV
KTKPKWQPGGVQQLQSPEFPPPPTDSNAAFVAAAPPPPPPPPPPLHTAPVTGLAPPPPPP
PPPAPVTGNLGSPTKRPPSSSLNIGGKKAPPTPQRNSSVKSNSSGFYEESRKNLLSKFAP
QNAASSAPCVSPSSKDPANGPPAPPKPGKLNLANLPMALQAKVSQAKKSSGEFPSPPPEC
AYFPPPPPASELFPPPPPPPGGEAHCGGAPKVAVVNPQPQAPPPPPPVSLVSNLSWGKSS
LKKTTLVQRSNNTPEPPPLSSPPATSPKGSSGQPNFLEDLNRTLKRKSVGRQGSLNSSAL
AGKLDPAGTMDDMALPPPPPELLLDNGKQSNGGNGGYMSGNISGYATLRRGPPPAPPKRG
DATKLTGEC
Download sequence
Identical sequences H2T7Z2
ENSTRUP00000020782 31033.ENSTRUP00000020782 ENSTRUP00000020782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]