SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000021130 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000021130
Domain Number 1 Region: 390-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-23
Family MAM domain 0.0042
Further Details:      
 
Domain Number 2 Region: 51-181
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000487
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 225-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000128
Family EGF-like domain of nidogen-1 0.099
Further Details:      
 
Domain Number 4 Region: 170-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000021130   Gene: ENSTRUG00000008437   Transcript: ENSTRUT00000021218
Sequence length 539
Comment pep:novel scaffold:FUGU4:scaffold_103:473051:479383:1 gene:ENSTRUG00000008437 transcript:ENSTRUT00000021218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTVTDMQPLTVLCVLFLLLHICSGSADSQRHYRQVLTGNQVGVCRYGRRLECCYGWKKNS
KGQCEAQCVHGCKHGECVGPNKCKCFPGYTGKTCNQDLNECGLKPRPCEHRCMNSYGSYK
CYCLNGYTVTPDGSCTNSRTCSLAHCQYGCEEVQGEIRCLCPSPGLQLGQDERTCVDIDE
CVTGKNLCPYNRQCVNTFGSYFCKCQEGFDLKYVDGKYDCVDHDECATDTHKCSHHADCL
NTQGSYKCKCKSGFRGNGFECSAAMNIVILQPQVSTAEEYCVEMLINLHNFSKPDEQLKN
FIPESIVTLPPQIPLQPFDYEREVYAGSQARGNREEEFPEEEEEEEEVHNQLNPRGDVFS
KQPFGKSVISPVDLSTTGPLRIFHSLDFFMDCNFDQGACEWVQDKADSIDWSAIYHDDGN
GYYMALSGLVGEQGDTAKLKLLLSDRAQQGSFCLTFDYRILGQNVGTIKVLLDNNSYPVW
EQSQSRQQSWQTEFLTVAWKEEAPQAVSHIVFEAQRGNSVGGEIGLDNVVLTSGPCQDE
Download sequence
Identical sequences H2T8Z0
31033.ENSTRUP00000021130 ENSTRUP00000021130 ENSTRUP00000021130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]