SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000023176 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000023176
Domain Number 1 Region: 372-450
Classification Level Classification E-value
Superfamily SH2 domain 8.21e-21
Family SH2 domain 0.000011
Further Details:      
 
Domain Number 2 Region: 450-488
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000131
Family SOCS box-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000023176   Gene: ENSTRUG00000009215   Transcript: ENSTRUT00000023273
Sequence length 502
Comment pep:novel scaffold:FUGU4:scaffold_52:680980:682650:-1 gene:ENSTRUG00000009215 transcript:ENSTRUT00000023273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSHRGTMWSNLKSKCQTLFHNNSNPGPADSGPEADAVRCTLGGAAASGASSPSRRLQPAP
AASAGRRHHNCVSNVPQIVEITIDKESEDVRGDVGAVPLARRDSYSRHAPWGGKKKHSCS
TKTQSSLETERRSGRVRGSGNRRDRRCGVGSIQEMSEGVCGGRGLNARSLRQRLSDTVGL
CLPLPAHRRARSARSPVVSKRKIHLTELMLETCPFPPGSDLALKWHLIKQHTAPVSPHSS
TALLDAFDPAHPSPEDEEERLRERRRLSIEEGVDPPPNAQIHTLEASVPGSSLYKLGPKM
APGMGEASGEARAGLGAAAPAQDCESEEDSTTLCLQARRPKQRHASGEGHLSRQQTGPWK
VHTQIDYIHCLVPDLLQITALPCYWGVMDRYEAEALLDGRPEGTFLLRDSAQEDYLFSVS
FRRYNRSLHARIEQWNHNFSFDAHDPCVFHHLARAAICRWTTYDGIGSLPLPPALQDFLK
EYHYKQKVRVRWLEREPPLKVK
Download sequence
Identical sequences H2TET3
ENSTRUP00000023176 31033.ENSTRUP00000023176 ENSTRUP00000023176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]