SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000023665 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000023665
Domain Number 1 Region: 407-498
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 7.46e-40
Family Small-conductance potassium channel 0.00000342
Further Details:      
 
Domain Number 2 Region: 276-447
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-28
Family Voltage-gated potassium channels 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000023665
Domain Number - Region: 483-534
Classification Level Classification E-value
Superfamily Coiled-coil dimerization domain from cortexillin I 0.0706
Family Coiled-coil dimerization domain from cortexillin I 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000023665   Gene: ENSTRUG00000009421   Transcript: ENSTRUT00000023763
Sequence length 587
Comment pep:novel scaffold:FUGU4:scaffold_243:363525:378571:1 gene:ENSTRUG00000009421 transcript:ENSTRUT00000023763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAGRRRPLWHHRHQQQQQQQQHRRGRQRGSLGSSHRDSNSYNEIAMSSCRYNGGVMRPLS
NLSSSRRNIHEFDSESQPLQPISAADASDALVSKPENNSTTLMPYASGDGGGGCGHSGGK
SGKKKNQNIGEKLGHRRALFEKRKRLSDYALIFGMFGIVVMVVETELSWGAYGKESLYSL
ALKCLISLSTIILLGLIIIYHAREIQLFMVDNAADDWRIAMTYERIFFICLEILVCAIHP
VPGNYTFTWTARLAYSYVPSKTDADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSI
GALNKINFNTRFVMKTLMTICPGTVLLVFTISLWIIAAWTVRACERYHDNQDINSNFLGA
MWLISITFLTIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVAKKLELTKAEKHVHN
FMMDTQLTKRVKNTAANVLRETWLIYKNTKLVRKTDHAKVRKHQRKFLQAIHQLRSVKME
QRKLNDQANSLVDLAKTQNIMYDMVSDLNEREENMEKRIAALETKLEALLSNLQALPGLI
SQVISQQHRDFLEVQLQPYDKHSPERSQSASRRRSSSTAPPTSSDSS
Download sequence
Identical sequences H2TG67
31033.ENSTRUP00000023665 ENSTRUP00000023665 ENSTRUP00000023665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]