SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025134 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025134
Domain Number 1 Region: 656-804
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.96e-43
Family Toll/Interleukin receptor TIR domain 0.00000169
Further Details:      
 
Domain Number 2 Region: 36-179,359-556
Classification Level Classification E-value
Superfamily L domain-like 5.61e-40
Family Ngr ectodomain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025134   Gene: ENSTRUG00000009990   Transcript: ENSTRUT00000025237
Sequence length 815
Comment pep:known scaffold:FUGU4:scaffold_203:376249:378696:-1 gene:ENSTRUG00000009990 transcript:ENSTRUT00000025237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMTMSQNSFCPLVLFRLMMGSTIAIFCAAAMLMPQLSVSYLRNYIDLSSRNLSSVPGDLP
KEAEYIDLSLNHIRQLKRGDFRNTPILRFLNISGNCLDSIHPETFLHTPLLEDLDLSHNE
LKDLMDQPYLQHTENLVALNLAHNKFLTMTLAREFGSLVKLQRLTLGGSTISVGDFRNIA
DVELRVMSLFLEGVLVYEPGSLQDVYARRLQVKFNNKFPHDLMEDALSFFPEVELLELSR
GYQELSKQLSQRSEIYTSCLYLTHISINWPDFTQYVHVALNTTVTHLGVSGVTMYRLPQN
ATPVAETSRVKSLTFRRAVVRSFLFSQEAVYNFFINMPVENLALTETSIIHMTCPKSESP
ITQLNFSYCSMTDTIFSRVEGLITVECKTLGNVRTLALAGNNLKSLKSLSIRMQYMKSLQ
DLDLSLNLLVYDGQKGCVWPQNISSMSLSSNGLTDSVFQCLPENVERLDLQNNQISAVSS
STLGLVRLWYLNLNANKLLDLPVCHNFPLLQELLLKSNSLHTPSVDRLKSCRSLKTLDAS
SNPFTCTCDLIGFIQLGLKFEKGGAAVTFLQWPHGYYCSYPEAVRDSNLNNFWIPEISCN
SYLLAAAILCPAVVVMTVVLTLCRHFDIPWYLGMIWQWMQAKHRARQRQPRPEVLLGIEF
HAFVSYSQKDAAWVFDHLLPNLESPAGGLRICHHGKNFVPGKPIINNIMTCVEKSRRCVF
VLSAHFVKSDWCHYELYFTSHQHLALGSDSVVLVLLEPVPQYLIPSKYYQLKFMMARHTY
LEWPQDRAKQRLFWANLRAALQADLPHLTVTEIEE
Download sequence
Identical sequences H2TKD0
31033.ENSTRUP00000025134 ENSTRUP00000025134 ENSTRUP00000025134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]