SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000025841 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000025841
Domain Number 1 Region: 67-253
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-24
Family Ankyrin repeat 0.002
Further Details:      
 
Domain Number 2 Region: 374-415
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000123
Family SOCS box-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000025841   Gene: ENSTRUG00000010266   Transcript: ENSTRUT00000025946
Sequence length 436
Comment pep:novel scaffold:FUGU4:scaffold_18:1136235:1139871:-1 gene:ENSTRUG00000010266 transcript:ENSTRUT00000025946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLHGFRRIIYEYQPLVDAIMCAVGMEEGDQGDRVRSPEEQSGICSSLVELLERESHSE
VFREGISYALFKVAERGLLYAAEILLRYGADLNFEDPVSYYNPLHVAVLRNRPTMVRLLV
SHGADIEKRDRIHESSPLDLASEESERLLCLLTLLDMGADVNAGDKHRKTPLLHALASSD
GLTVHNTGNIQLLLQRGADISAATQDGETVESLLVFLIKEALDANEEDAAEIGKFCLKTT
RLLLAHGLDPSCCLNEDGESSLTRTSLEHFDLLFPLAVLLIQSGSSLVCSLHGDSCWFAY
GLLFQRLQTALQQSSDQSHALELIEQAEALLNLARVDLPVLRAPSWLEIPEQSHDPHPYS
QALLDLRDRILARDSNPPALRCLCRAFIRGQLQPWPLEDRVKTLPLPDRLKEFLLPELTY
TPKPGWDRFKPQHSHS
Download sequence
Identical sequences H2TMD5
ENSTRUP00000025841 31033.ENSTRUP00000025841 XP_003974551.1.43653 XP_011613510.1.43653 ENSTRUP00000025841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]