SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000026649 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000026649
Domain Number 1 Region: 54-153
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-23
Family SH2 domain 0.00062
Further Details:      
 
Domain Number 2 Region: 156-204
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000126
Family SOCS box-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000026649   Gene: ENSTRUG00000010558   Transcript: ENSTRUT00000026757
Sequence length 205
Comment pep:known scaffold:FUGU4:scaffold_112:363592:364785:1 gene:ENSTRUG00000010558 transcript:ENSTRUT00000026757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVANGAVTDQDKLRDQQPQDTPQSSQLQNWATAGAKPTSAAISLYRTHFPTFSCQEDCNI
ITDTASKLERCGFYWGPLGVEDAHRMLRDAPLGSYLIRDSRQKDVFFTLSYHAKGGPVSV
RLTYSRQKFSLAGNERSFPTLFALLEYYVSSPKKSLSVPYRKWQPTLQELCRKRIMSITG
GGSQISDLPITRVAQGFLLEFPYKL
Download sequence
Identical sequences Q0GRC3
ENSTRUP00000026649 NP_001092110.1.43653 ENSTRUP00000026649 31033.ENSTRUP00000026649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]