SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028196 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028196
Domain Number 1 Region: 22-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.63e-50
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 273-313
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000262
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028196   Gene: ENSTRUG00000011170   Transcript: ENSTRUT00000028308
Sequence length 315
Comment pep:novel scaffold:FUGU4:scaffold_42:517194:520008:1 gene:ENSTRUG00000011170 transcript:ENSTRUT00000028308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRLGELRSSTLPPEFCCFIFIMAAVQTEPSHFSQFWQRPFSIYGGLTCNSLMADSWSDRT
PLHDAAYQGRLLTLRTLISQGFHVDTLTMDLVSPLHEACLGGHYACAMFLLENGANVDAV
STDGATPLFNSCSSGSAACVRVLLQHGATLNTPSLLASPIHEAAKQGHTECLDLLLSWGA
HADVELPAVGTPLYSACAARAADCAMSLLHSGADVETGCGQDTPLHAAARSGGADIVDLL
LDFGADRWSRNPEGKTPLDLSPPNSSVRLVLQKRGPCSLSQLCRFCIRRCLGRSRLHRAS
SLFLPRSIKDFLLCQ
Download sequence
Identical sequences H2TU38
ENSTRUP00000028196 ENSTRUP00000028196 31033.ENSTRUP00000028196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]