SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000028285 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000028285
Domain Number 1 Region: 883-1155
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.09e-88
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000185
Further Details:      
 
Domain Number 2 Region: 1116-1416
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.63e-79
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000114
Further Details:      
 
Domain Number 3 Region: 3-162
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-38
Family MAM domain 0.00000687
Further Details:      
 
Domain Number 4 Region: 364-568
Classification Level Classification E-value
Superfamily Fibronectin type III 7.03e-28
Family Fibronectin type III 0.00061
Further Details:      
 
Domain Number 5 Region: 260-396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000422
Family Fibronectin type III 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000028285
Domain Number - Region: 163-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000406
Family I set domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000028285   Gene: ENSTRUG00000011205   Transcript: ENSTRUT00000028397
Sequence length 1419
Comment pep:novel scaffold:FUGU4:scaffold_61:789955:838584:-1 gene:ENSTRUG00000011205 transcript:ENSTRUT00000028397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGCTFDQDSDPGFCDYRQGQDDDFDWQLIRTYNWPHPTPDLLRGSFMMVNSSQHFGGQR
AQLLLLPLSENDTHCIQFSYFLYSRDGHSPGDLQVYIRVNGGPKGSAVWNISGSQGRQWH
QVELAVSTFWPSEYQVIFEATVSEERQGYVALDDIVLLNYPCYKVPHFSRLGDVEVNAGQ
NASFQCVATGKVSESEPFLLERRSGLLLDAPALSRLSHKRLMATFQVEAQRGEQDLYRCV
TLSPRGAAISNFGELIVRVPPTPIAPPQLLRAGPTYLIIQLNTNSIVGDGPVIRREIQYR
ASQSMWTETHGVGSLTYKVWHLEPDTEYHISVLLTRPGEGGTGAPGPPLISRTKCAEPMR
ALRGLTASDIQPRQLTLQWEPLGYNLTRCHTYTLSLCYRYSVPTGGSGGNNATVRECLSV
DRNTSRFTLRDLPPFHSVHVRLALSNPEGKKESREVTFQTEEDIPGGIAPESLTFTPLDD
MIFLKWEEPVEPNGLITQYEISYQSIESSDPGINVPGPRRTVSKLRNETYHMFSGLHPGT
TYLVSVRARTAKGFGQTALTEITTNISAPVFDYEDVPSPLSESESTITVLLRPALARGAP
VSAYQVVVVEEDGSRQVRRREVGPVDCFPTPSSHSSQSRGAPHYYTAELAPSSLPEATPF
TVGDNHTYNGYWNSPLDPTKNYLIYFQATSNFRGETRINCIRIARKAACKDSKRALEVSQ
HAEDMGLILGACVGGLVVLVLLLGAVVVIVKKGRVVFASSSLFSLLLLRRALEAAGENSA
ERREGERDVWASVAAGAFLNRIRSGIPTPTPRNRGNPLMGGRLRGSQTPPPPPFPPPPPH
SAGVGRCRAELVLLFTLMIIGFLLLNALFPVVQSFFDGWDVSKKKDKTKGRHDSLLSHDR
HRVKLHSLLADPCSDYVNANYIDGYQRSNHFIATQGPKQEMIYDFWRMVWQENCFSIVMI
TKLVEVGRMKCCKYWPDDTELYGDIKITLLKTETLAEYTVRTFAMERRGYPAKHEVCQFH
FTSWPEHGVPYHATGLLAFLRRVKASTPPDAGPVVVHCSMGAGRTGCYIVLDVMLDMAEC
EGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGETAVPVNEFALTFKEMLKV
DTQSNTSQLREEFQTLNSVTPHLDVEECSISLMPRNREKNRSMDVLPPDRSLAFLVTTDG
ESSNYINAALADSFLRPAAFVVTPHPLPGTTTDFWRLVYDYGCTSVVMLNQLNQSNSAWP
CLQYWPEPGLQQFGPMTVELLSRTADDDVIIRLFRVQNITRLQEGQLVVRHFQFLRWSPY
RDVPDSKKAFLSLLAQVHNWQRECGEGRTVVHCLNGGGRSGTFCACTMILEMIRHHSVAD
VFFAAKTLRNAKPNMVETMEQYRFCYDLAQEYLECLEVR
Download sequence
Identical sequences H2TUC6
ENSTRUP00000028285 31033.ENSTRUP00000028285 ENSTRUP00000028285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]