SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030380 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030380
Domain Number 1 Region: 18-115
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-23
Family SH2 domain 0.0001
Further Details:      
 
Domain Number 2 Region: 145-194
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000301
Family SOCS box-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030380   Gene: ENSTRUG00000012004   Transcript: ENSTRUT00000030497
Sequence length 195
Comment pep:known scaffold:FUGU4:scaffold_87:457888:458553:-1 gene:ENSTRUG00000012004 transcript:ENSTRUT00000030497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPAPPAAWGPSEDYRSITATFRYLETSGWYWGPTSVSDAQEALLRKSEGTFLMRDSNHPK
HMLTLSVKTCCGPTSVRIEYSRGSFWLDSIAAGQLRTQTFPDVVSLVQHYMTLGHVPQSH
THSDMYQRAKPDPSGDAARGCDVPLKLMFPLHKPGGFPSLRHLTRLAINRHASCPDQLPL
PKLLLRYLQDYPFHI
Download sequence
Identical sequences H2U0C1
ENSTRUP00000030380 ENSTRUP00000030380 31033.ENSTRUP00000030380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]