SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000030743 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000030743
Domain Number 1 Region: 585-687
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.21e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 729-825
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.62e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 3 Region: 973-1049
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000208
Further Details:      
 
Domain Number 4 Region: 440-510
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.34e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000495
Further Details:      
 
Domain Number 5 Region: 134-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.78e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000317
Further Details:      
 
Domain Number 6 Region: 1053-1125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.000057
Further Details:      
 
Domain Number 7 Region: 293-370
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0021
Further Details:      
 
Domain Number 8 Region: 505-580
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 9 Region: 221-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0034
Further Details:      
 
Domain Number 10 Region: 348-434
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000997
Further Details:      
 
Domain Number 11 Region: 1119-1196
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000258
Further Details:      
 
Domain Number 12 Region: 869-921,949-972
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000643
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 13 Region: 806-870
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000506
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000030743
Domain Number - Region: 102-150
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0501
Family Eukaryotic type KH-domain (KH-domain type I) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000030743   Gene: ENSTRUG00000012148   Transcript: ENSTRUT00000030860
Sequence length 1269
Comment pep:novel scaffold:FUGU4:scaffold_67:699812:709853:1 gene:ENSTRUG00000012148 transcript:ENSTRUT00000030860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQEIFNEHRSGLLPEQSNAAVAGTSVGEEEDALPTYKEAFPPLPEKAASPEGT
QETANAWTSKIRSLKSSIITQVFHVPLEERKYKDISQFGEGDQAKVCVDIMQKTGAHLEL
SLAKDQGLSIMVSGKMDAVMKARKEIVSRLQTQASTTVAIPKEHHRFVIGKNGEKLQELE
LKTATKIQIPRPDDLSNQIKISGTKEGLEKAKHEILLISAEQDKRAVERVNIDKVYHPFI
TGAYNKLVGELMQETGARINVPPPSVNKTEVVITGEKEQVALAIVMIKKIFEEKKKNTTT
IAVEVKKSQHKYVIGPKGNTLQEILDKTGVSVEIPPSDSSSETIILRGEPDRLGQALTEV
YAKANSYTIGMVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDRITLEGPTKDV
QMVQSQIEVTVADLISRMDYTEITVDPKFHRHLIGKGGVNINRIKELHKVTVRIPPDNEK
SNLIRIEGDPQGVQEAKKELLELASRMENERTKDLIIEQRFHRAIIGQKGEKIKEVRDKF
PEVIINFPDPAQKSDIVQLRGPRNEVEKCAKFMQKIVAEMVENSYSVSVPIFKQFHRNII
GKGGSNIKKIREETNTKIDLPAENSNSEMIVITGKKANCEAARNRVLAIQKELANITEME
VSIPSKLHNSLIGSKGRFVRSIMEECGGVHIHFPTEGSGNDKVTIRGPVEEVAKAKQQLL
ALAEEKQTKNFTAELQAKPEYHKFLIGKGGGNIRKVRDSTGARIIFPTADDKDQELITVI
GTEEAVQEAQKELEELIKGLDNVIEDTMTVDPKHHRYFVSRRGQVLRDLADEYGGVMVSF
PRTGSQSEKVIIKGAKECVEAAKKRMQEIVEDLDAQVTVECVIPQKFHRSIMGPKGSRIQ
QITRDHNVLIKFPEREDLQAPSADIAVKENGETNGELKEALDPNAPKKCDVIVISGRKER
CDTALEALKALVPVTIEVEVPFELHRYIIGQKGSGIRKMMDEFEVNIQVPAPDQQSHNIY
ITGLASQLDRAKEGLLERVKELQAEQEDRALRSYRLTMTVDPKYHPKIIGRKGAVITNIR
TEHDVNIQFPEKNDESQDQITITGYELKAIAARDAIQAIVDELEEMISEDITLDSRVHAR
IIGARGKGIRKIMDEFKVDLRFPPTGAADPNLVTVIGRPELVDEAIDHLLNLEEEYMADV
VENEAKMAYRRPAASAADEHRGPSKGFVVREAPWATANEKAPDMSSSEDFPSFGAPVATK
ASPWGPKRF
Download sequence
Identical sequences H2U1D2
ENSTRUP00000030743 XP_003973835.1.43653 ENSTRUP00000030743 31033.ENSTRUP00000030743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]