SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031111 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031111
Domain Number 1 Region: 1030-1340
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-78
Family Protein kinases, catalytic subunit 0.000000000443
Further Details:      
 
Domain Number 2 Region: 324-484
Classification Level Classification E-value
Superfamily L domain-like 2.21e-49
Family L domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 1-158
Classification Level Classification E-value
Superfamily L domain-like 3.97e-43
Family L domain 0.00000128
Further Details:      
 
Domain Number 4 Region: 517-636
Classification Level Classification E-value
Superfamily Fibronectin type III 1.21e-29
Family Fibronectin type III 0.00000361
Further Details:      
 
Domain Number 5 Region: 640-719,823-846
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-19
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 6 Region: 817-964
Classification Level Classification E-value
Superfamily Fibronectin type III 5.55e-19
Family Fibronectin type III 0.0002
Further Details:      
 
Domain Number 7 Region: 218-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000044
Family Growth factor receptor domain 0.0000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031111   Gene: ENSTRUG00000012281   Transcript: ENSTRUT00000031229
Sequence length 1432
Comment pep:novel scaffold:FUGU4:scaffold_122:593251:620631:1 gene:ENSTRUG00000012281 transcript:ENSTRUT00000031229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCQSKDIRNDVTNLQSLENCTIIEGYLKILLMFKTKPDDFHGLTYPKLQVVTDYVLLFRV
YGLETLGDLFPNLTVIRGNNLFFNYALVLYEMLQLKEVGLHSLMNITRGAVRIEKNPDLC
YLSTLDWSKILDSVEDNYIVANKNERECGDVCPGTAHGQTICPQNTINGHFRGRCWSQNH
CQRRGLPAGKSGIKACVAWCWLCAETCKHGTCSLQGQCCHDQCLGGCSEPGNASSCVACR
NLLHSNTCVEKCPPGYYIFRGWRCVSFSFCQDLHNQCKRMKNLNQDIEPGCFEYVIHDGA
CIPECPSGYTTVNSTTLTCSPCAGLCPKLCLGNNTIDSVTSAQAFRGCTVIQGNLIIKIR
GGNNIAAELEASLGQIEEITGYLTVRRAYALVSLSFLRKLRVIKGEHLEADTYSFYALDN
QNLRELWDWTKHNLTIQRGRTFFHYNSKLCMSEIKKMVAITGAENRNQKNDIAGRTNGDQ
ASCELSRRSFVLHLLVQARVHRVHRDPLLCVVGETKLLKFTTIKTTFNMIMLKWETFWPS
DFRDLLGFMVLYKEAPYRNVTEFDGQDACGSNSWTIADVDPPSRPTDGKKPENPKHLIRP
LKPWTQYAIMVKTQLSASDEHQVHGAKSEIIYILTNASNPSAPLDPISSSNSSSQIILKW
KPPTSPNGNITHYQVICRKQPEDGDLYKFDYCLQGMKLPSRTPTHLDSEEEQKWNHTDEP
TSGGRCCACPKTDNQLKKEQEEIEYRKTFENYLHNKVFEIRPHLLPCSFRPSRRRRSVGV
ANATQSSFFLPTVPNVLLRSTTATPNQDEDEKVELKVDKESTVISNLHHFTSYKIEIMAC
NHPTDPKRCSIATYVSARTMPEEKADDIPDQVTHEIVAAEPPYVLIKWKEPQSPNGLIIL
YEVFYGKVGDAEVHTACVSRPAYQKTGGTKLSLVQPGNYSLRVRATSLAGNGSFTNITYF
FMPSPDPGLIWIVMGPVICFILLLCLGIGVFVIFKKKQTEGPTGPLIASSNPEYLSANDD
GCNRSSRFFTCCVLAAVYVPDEWEVPREKITLLRELGQGSFGMVYEGIAKDIVKGDPETR
VAVKTVNESASLRERIEFLNEASVMKAFSCHHVVRLLGVVSKGQPTLVVMELMTHGDLKS
YLRGLRPDSEVCDGNSGRHFHLPHTRRRVLLQNNPTGRPPPTLKEMIQMAAEIADGMAYL
NAKKFVHRDLAARNCMVAEDYAVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKD
GVFTAHSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGSLDRPDNCPERMHNLMQ
MCWQYNPKMRPVFHEIIEMLREDLHPSFHEVSFFYSEENKVPETEEFDLDLDNMESIPLD
PSSYSQREESLGRDSGPSVALRGNYEEHVPYTHMNGGKKNGRILSLPRSSPS
Download sequence
Identical sequences H2U2F0
ENSTRUP00000031111 31033.ENSTRUP00000031111 ENSTRUP00000031111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]