SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000031356 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000031356
Domain Number 1 Region: 368-469
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 6.1e-19
Family SWIB/MDM2 domain 0.013
Further Details:      
 
Domain Number 2 Region: 93-181
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000000023
Family PUA domain 0.0042
Further Details:      
 
Domain Number 3 Region: 472-569
Classification Level Classification E-value
Superfamily eIF1-like 0.000000000000235
Family eIF1-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000031356   Gene: ENSTRUG00000012383   Transcript: ENSTRUT00000031478
Sequence length 578
Comment pep:novel scaffold:FUGU4:scaffold_75:1074904:1080481:-1 gene:ENSTRUG00000012383 transcript:ENSTRUT00000031478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVRPFRVKSNTAIKGSDRRKLRADIAAAFPSLDADDLSELVPNKEELNIVKIYAHKGDA
VTLYVLHKNPLFFELEKRLYPTVYALWRYPALLPIFRTWPPVIQKLLGGADLMLPGVVLP
SSGLPHVQQGDCCAVTVVSNRAPVAVGTAALSSAEMLSSGMRGRGVSVLHTYMDNLWSFG
DKSGPPALPDLESEGGEANGEECDHAEEEQEEEAEQENERSIEEDEQEDQKTTQGILYTK
SQMKGLEPSSTLPAEDMDALLLQCFLHALKQKVKKSELPLLTSTFLRNHMFSCCPSGKKL
DMKKSSYKKLSKFLQAMQRHNLVRLKELTKGVESIVEVDWKNEELRSFRAPEEADLEACV
MDAGEGQTPYCPPEIVILYSVSARTEPLFLDANKRKGTILQPSEVRNIITEYVKNNELVN
ENNKNYVSINPTLCDCLLEKSEFQEVDSLKWDDLFSRTLGRMQECYQLVFPGQAPVIKKG
HIEQIDISVASRGSNKKVTLIKNLEVYGLDPTMVSTTLQHRVQASTVLQPIPGSKDKVLV
QVQGNQIHQAGSLLLDYFKIPRKYIQGLEKAPKGGKKK
Download sequence
Identical sequences H2U345
ENSTRUP00000031356 31033.ENSTRUP00000031356 ENSTRUP00000031356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]