SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032413 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032413
Domain Number 1 Region: 16-211
Classification Level Classification E-value
Superfamily Kelch motif 6.93e-29
Family Kelch motif 0.0062
Further Details:      
 
Domain Number 2 Region: 191-359
Classification Level Classification E-value
Superfamily Kelch motif 5.62e-27
Family Kelch motif 0.022
Further Details:      
 
Domain Number 3 Region: 1632-1809
Classification Level Classification E-value
Superfamily Fibronectin type III 4.12e-19
Family Fibronectin type III 0.0000337
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000032413
Domain Number - Region: 362-404
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00382
Family Fibronectin type III 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032413   Gene: ENSTRUG00000012807   Transcript: ENSTRUT00000032537
Sequence length 1845
Comment pep:novel scaffold:FUGU4:scaffold_79:730036:739283:-1 gene:ENSTRUG00000012807 transcript:ENSTRUT00000032537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVEVMSATGTTASVLQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KKLKAKNPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRA
GSSVVGWDIPITYGVLPPPRESHTAVVYTDKASRKSRLIIYGGMSGCRLGDLWTLDIDTL
TWNKPSVSGTAPLPRSLHSATTITNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDNMCWETVLMDTLEDNIPRARAGHCAVAINSRLYVWSGRDGYRKAWNNQVCCKDLWYLE
TERPHAPARVQLVRANTNSLEVSWGAVSTADTYLLQLQKYDIPATPAAASPAMSATSSLP
VNSPKSPALAAAAPSAQSLPQTVFFLLVSLMKFSVMCKFLSVMVVHFCPAVLKVAAQQSA
TGASVVTVRPSQPIKSPVTVTSLPPGVRMVVPAQSTQGTPIGSSPQMSGMAALAAAAAAT
QKIPPSSAGTVLNVPAGATILKTVAVTPGATTMKVASPVMVSNPATRMLKTAAAQVGTAA
AASPTTTRPIITVHKSGTVTVSQQAQVVTTVVGGVTKTITLVKSPLAMGGSGAMISNLGK
MMSVVQTKPVQTSAVTGQASTNPLTQIIQTKGPLPAGTILKLVTSADGKPTTIITTSQAG
GTGNKPTILNISGVSPTTTKQGTTIIKTIPMSAIMTQPGATGVTSSTGIKTPITILTTKV
MTTGTPGKIITAVPKLATAAGQQGLTQVVLKGAPGQPGTILRTVPMSTMGGVRLVTPVTV
SAVKPTVTTLVVKGTTGVTTLGTVSGTVSTSLAGNTVDSSNASLVTPITTLGTIATLSSQ
VITPSAITVSAAQTSLTSASTLPSSTMTVQVVQNQPTQVTLITTPSGVEAQPVQDLPVSI
LASPTSEQPSSTEAGAAGDGSGTVTLVCSNPPCETHETGTTNTATTSSATMGAGKVCSNP
PCETHETGTTNTATTSSATIGAGKVCSNPPCETHETGTTNTATTSSATSEREKCVPTHPV
RPTRREQPIQLQLPLLPSEREKCVPTHPVRPTRQGTTNTATTASSNMSALRVCSNPPCET
HETGTTNTATTASANIGQPRQVCSNPPCETHVTGTTNTATQSSSNMNTSLTGTTQRVCSN
PPCETHETGTTNTPSTATSSMGGEQTSTVTGIVQQECSNPPCETHETGTTNTATTATCSM
ETTEGTVYYTATQQTEEEAKAASNTEVVATTAATDIVTTTQGRAITTVTQSTPAPGPSVP
VRKSLLSELFNMPLEIISHPVPNLFSGSCLQLISSITEGVSTAESSTEEPMQTDETPSAE
SAPAAEEAAAAVAMEAQAEGETATAAALNLPSELMTEGQGATLMVTGLSDEELAVTAAAE
AAAHAAATEEAQALAIQAVLQAAQQAVMSEAGYCPLTGEGDSTAETQQPTNIPIMLTQQE
LAALVQQQQLQEAQAAAQQASVGTSLPTEGLAPADSLNDPSVESNGHNEMAAAVTSAVAS
LLPCATAETLAPSSTFAPVVSVASPAKLQAAATLAEVANGIEGEKQDPQPAPVKPAVKKE
NQWFDVGIVKVTNMVVTHFYVPADDSHGDDDSGVVPDYAQMKKMELQPGTAYKFRVAGIN
ACGRGSFSEISAFKTCLPGFPGAPCAIKISKSSDGAHLTWEPPSVTSGKIIEYSVYLAIQ
SNQTAEAKASTPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGY
GPATQVRWLQESGKDASSAKPAPKRPGTSPDAKATGPKKARTDQS
Download sequence
Identical sequences H2U647
ENSTRUP00000032413 31033.ENSTRUP00000032413 ENSTRUP00000032413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]