SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032485 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032485
Domain Number 1 Region: 39-510
Classification Level Classification E-value
Superfamily Sema domain 2.49e-127
Family Sema domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 1365-1492,1687-1876
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-50
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 869-968
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000112
Family Other IPT/TIG domains 0.0066
Further Details:      
 
Domain Number 4 Region: 966-1055
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000168
Family Other IPT/TIG domains 0.066
Further Details:      
 
Domain Number 5 Region: 1053-1156
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000267
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.096
Further Details:      
 
Domain Number 6 Region: 512-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000401
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1153-1244
Classification Level Classification E-value
Superfamily E set domains 0.00000115
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 8 Region: 812-845
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000589
Family Plexin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032485   Gene: ENSTRUG00000012831   Transcript: ENSTRUT00000032609
Sequence length 1906
Comment pep:novel scaffold:FUGU4:scaffold_118:776392:915766:1 gene:ENSTRUG00000012831 transcript:ENSTRUT00000032609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAFTTMALYHIPVCIIALLLLFISMASTSLPPTSSSSLLFFSPPEGGLTHLVVNNKTGEV
YLGAVNWIYKLSSNLTKLRSHVTGPVTDNPRCYPPPGVQSCPHELVQTSNVNKLLLLDAA
HNRLIACGSTSQGICQFLRLDDLFKLGEPHHRKEHYLSSVAEAGTMSGVVISPDVFGGGG
KLFVGTPIDGKSEYFPTLSSRKLMSNEENADMFSFVYQDEFVSSQLKIPSDTLSKFPAFD
IYYIYGFNSEQFVYYLTLQLDTQLTSPDASSEQFFTSKIVRLCVDDPKFYSYVEFPIGCT
KDGVEYRLVQDAYLARPGIRLARSLGIQEHEEVLFTVFAQGQKNRAKPPKESALCLFTMK
RIKEKIKERIQSCYRGEGKLSLPWLLNKELACINSSPKPQPLQIDDNFCGQDFNQPLGGT
SAIEGPLYVDKDDGMTSVAAYNYRGHTVAFTGTRSGRMRKILVNSIVQPAPQYENVVVSD
GHSILRDLLFSHDHQYLYTLTDKQVTRVPVERCEQHKSCRACLGSGDPHCGWCVLLNTCS
RKDHCERAEEPQRFTTRVEQCVRLSVQPDTVSVTMSEVQLVLQAQNVPSLFAGVNCSFED
YVETEGRIYGGRIFCLSPSRKDVLPITQNQGDQRVIKLYLKSKETGKKFASVDLVFYNCS
VHQSCLSCVNGKFPCHWCKYRHMCTQDATDCSFQEGRVNTSEECPQILPSTQIYIPAGVV
RPITLLAQNLPQPQSGQKNYECIFHIQGSTLRVPALRFNSTSIQCQKTMYDYEGSDISDL
PVDLSVVWNGIYVIDNPFNIQAHLYKCRALRASCGMCLKANPRFECGWCVQDKKCSLRQE
CTSGGSPHVALLLSESGRWMHASSGNSRCSHPKITKLFPETGPRQGGTRVTILGENLGLQ
FRDIQMGVRVGKVPCLPVEEEYVSAEKIVCLLNDATSYRVQEAQVEVCVRDCVNDYRALS
SRPFTFVTPYFTRIQPSQGPISGGTRITIEGSYLNAGSYISVRFAQQPCFFKKRNAREIV
CVTPAGIAPGSTSVLVDIDDAELRNPEVRFNYTEDPTVLKIEPDWSIASGGTLLTVSGTN
LATIREPKIRAKYGQAESFHNCTVYNNSVMVCLAPSVADSELGFSESGTGPDEIGFYMDN
VNALVVVNETFSYYPDPVFEPLSPSGVLELKPTSPLILKGRNLIPAAPGNSRLNYTVLIG
ETPCILTLSESQLLCEWPNLTGQHKVTIRAGGFEYSPGMLHIYSDSLLTLPAIIGIGGGG
GLLLLVIIAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQE
LDGSGIPFLDYRIYAMRVLFPGIEDHPVLKEMEVQANVEKALMLFGQLLTKKNFLLIFIR
TLESQKFPRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLLL
RRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSE
DKLIRQQIDYKTLTLHCVNPEHENAAEVTVKCLNCDTITQVKEKLLDAVYKGSPYSQRPK
ASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSVIALVPKQNSAYNI
SNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHSDQREGDR
GSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHS
ITDFDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHK
LGKDSPSNKLLYAKDIPNYKNWVERYYSDISRMPAISDQDMSAYLAEQSRLHLSQFNSMS
ALHEIYSYITKYKDEILTALQKDEPSRRQRLRGKLEQVIDTMSLAS
Download sequence
Identical sequences H2U6B9
31033.ENSTRUP00000032485 ENSTRUP00000032485 ENSTRUP00000032485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]