SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000032957 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000032957
Domain Number 1 Region: 42-510
Classification Level Classification E-value
Superfamily Sema domain 5.1e-122
Family Sema domain 0.0000287
Further Details:      
 
Domain Number 2 Region: 1351-1480,1675-1864
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-51
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 859-957
Classification Level Classification E-value
Superfamily E set domains 6.07e-16
Family Other IPT/TIG domains 0.01
Further Details:      
 
Domain Number 4 Region: 955-1044
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000382
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 1043-1147
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000826
Family E-set domains of sugar-utilizing enzymes 0.059
Further Details:      
 
Domain Number 6 Region: 513-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000889
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 7 Region: 811-846
Classification Level Classification E-value
Superfamily Plexin repeat 0.000068
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1158-1235
Classification Level Classification E-value
Superfamily E set domains 0.000098
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000032957   Gene: ENSTRUG00000012993   Transcript: ENSTRUT00000033082
Sequence length 1894
Comment pep:novel scaffold:FUGU4:scaffold_54:994853:1033419:-1 gene:ENSTRUG00000012993 transcript:ENSTRUT00000033082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HPIKPASSTSFLLLLLLLLPLPFLFSPAAPPSPSVMSGRVVYKTFDTSLTHLTVHRKTGE
VFVGAVNRVLKLSANLTELRSHMTGPVEDNAKCYPPPSVRACAHRLEWSDNVNKLLLVDY
TGNRLVACGSIWQGVCQFLRLEDLFKLGEPHHRKEHYLSGAREADGMAGKLHLMKPERSG
SRLFIGAAIDGKSEYFPTLSSRKLVADEESVNMFSLVYQDEFVSSQIKIPSDTLSLYPAF
DIYYVYGFSSRTYVYFLTLQLDTQLTQMDAGGEKFFTSKIVRMCSNDTDFYSYVEFPLGC
TKDGVEYRLVQAAYKQKPGRRLAQALGLSEEDDVLFVIFSQGQKNRSNPPRETVLCLFTL
HDINLAMRERIRSCYRGEGRLSLPWLLNKELPCIHTPKKIGDDFCGLVLNQPLGGLRVIE
GNPLYEDRTEGMGAVAAYTYGEHTVVFVGTRSGQLKKIRVDGIPSPSQNALLYETVTVVD
GKPILRDMVFSPDHQYIYLLSDRQVSRLPVESCEQYTSCSDCLGSGDPHCGWCVLFNMCS
RQEACEKWEEPQHFNNKLDQCVDISVTPSNMSVTSPSTELTVRVQNVPALSGGVSCVFDD
LSETPGEVLAKGQVVCMSPSLRELPVHTQSYAEQRVVQLSLRSTETGHQFISTSFIYYNC
SVLNSCTSCVSSVFPCHWCKYRHICTNNLQDCSFQEGRVSNMEGCPQILPTSDILVPAGM
VRPITLRARNLPQPQSGQKNYECVFNIQGKVQRIPAVRFNSSCIQCQNTSYWYEGDESGD
LPVDFSIVWDGDFFIDKPMSMKALLYKCEAQRSSCGQCLKAPPAFECGWCVETRKCLLRQ
HCPTPEQSWMHHGRHNLRCSHPRITKISPLTGPREGGTRVTIEGENLGLQVKEITHVQVA
GVRCSSVPSQYISAERIVCDMAEALLPHSPGGPVELCIGVCSAEFRTLSSQTYSFVSPSF
SRVHPEKGPVSGGTRLTITGRHLDAGSTVSVYINKEECLFVKRTNREIICITPASSSGSG
PASIRLMIDKAEVTSSETKYVYTEDPTIISIEPNWTILNGSTMITVTGTNLLTIQEPKVR
AKYGGVETNNFCTLVNDSTMTCLAPGLVYNKSVPPEGALHPEEFGFIFDQVSSLLVLNST
PFTHYPNPIFDPLGNSGILEVKPGSPIILKGKNLIPPAPGNNRLNYTVLIGESPCLLTVS
ESQLLCDSPDLTGEHRVLILVGGLEYSPGMLHIYSDSALTLPAIIGIGAGGGVLFIAIIA
VLIAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMDGVKIPFL
EYCTYTMRVMFPGIEEHPVLKELDSPANVEKALRLFSQLLNNKIFLLTFIHTLEAQRSFS
MRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRRTESVAEKMLT
NWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKQ
LTLMCIPPEGEAGTEVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMDLEWRQGR
LTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQVSAYNIANSFTFTRSLSK
YESLLRTSSSPDSLRSRAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMVSEIYLTR
LLATKGTLQKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPDVRHTWKS
NCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLY
AKDIPNYKSWVERYYRDIAKMPSISDQDMDAYLVEQSRLHGNEFNTLSALSELYFYINKY
KEEILTALDRDGYCRKHKLRHKLEQAINLMSGSS
Download sequence
Identical sequences H2U7P1
31033.ENSTRUP00000032957 ENSTRUP00000032957 ENSTRUP00000032957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]