SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000035152 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000035152
Domain Number 1 Region: 78-173
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-23
Family SH2 domain 0.00011
Further Details:      
 
Domain Number 2 Region: 211-251
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000994
Family SOCS box-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000035152   Gene: ENSTRUG00000013763   Transcript: ENSTRUT00000035280
Sequence length 252
Comment pep:known scaffold:FUGU4:scaffold_56:826262:827993:-1 gene:ENSTRUG00000013763 transcript:ENSTRUT00000035280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILCVPGHIGNFPLFCRVFVKSLCVRECQDFLCVPRALPAAPAPEAPRGMRAGTGTPTPC
LQSTHPLWDPTKDLRAIASNFCYLENSGWYWGAITAAQAHAALQEASEGAFLVRDSSHPL
YMLTLSVRTARGPTSIRIQYSSAQFLLDSSSPARPNLSSFPNVPSLVQYYMGPKNKADGG
GLEKEGPSKSCAEPIQSTSVVLKLKRAVYKPHSLPSLQHLTRLVINRHSDCPEQLPLPKP
LLRYVQDYPFKV
Download sequence
Identical sequences H2UDY3
31033.ENSTRUP00000035152 ENSTRUP00000035152 ENSTRUP00000035152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]