SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000037308 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000037308
Domain Number 1 Region: 21-478
Classification Level Classification E-value
Superfamily Sema domain 7.59e-110
Family Sema domain 0.0000749
Further Details:      
 
Domain Number 2 Region: 1563-1690,1878-2064
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.24e-46
Family p120GAP domain-like 0.014
Further Details:      
 
Domain Number 3 Region: 1137-1228
Classification Level Classification E-value
Superfamily E set domains 6.86e-17
Family Other IPT/TIG domains 0.073
Further Details:      
 
Domain Number 4 Region: 1044-1138
Classification Level Classification E-value
Superfamily E set domains 0.000000000000377
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 5 Region: 481-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000227
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1225-1322
Classification Level Classification E-value
Superfamily E set domains 0.0000000784
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Weak hits

Sequence:  ENSTRUP00000037308
Domain Number - Region: 635-671
Classification Level Classification E-value
Superfamily Plexin repeat 0.0127
Family Plexin repeat 0.0093
Further Details:      
 
Domain Number - Region: 1353-1408
Classification Level Classification E-value
Superfamily E set domains 0.042
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000037308   Gene: ENSTRUG00000014605   Transcript: ENSTRUT00000037443
Sequence length 2097
Comment pep:novel scaffold:FUGU4:scaffold_54:1251988:1274142:1 gene:ENSTRUG00000014605 transcript:ENSTRUT00000037443 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISTLFLHLIFIIFGTIYSHSYPSFSCNDTEFQHLVLHPDPSMGTVYLGARDRLFQLDASE
GLHLKQEESTGPVSDSKDCLPPVTEVNCPQARKTSNYNKLLLVDPNALELITCGSIHQGT
CQKRSLTSIKKIIFSTERPVDTQYVAANDPMVSTVGLVVKLNCCEKTVMYVGRGYTASHP
PISTRHLSSEPIFSYEETAKLAVTGRLSEYDHHFVMAFTRHANVYFLFYRRDIKTPLREY
RTYAARLCLNDTSYYSYVEVPLVCQSPSTSSSSYNFLQAAQVPGSPKVGRGSGREIDNLL
GVFSSNPVSANKNPLDSSALCIYPLDELDQHFDSTRDLCYSKGGHVRGKGEVAYIEYEVK
SSCANLPLNTVKAYPCGSDHTPSPMASRKPQEAKAVLEIFSHHLTAVAVSVRKGHSIAFL
GDTKGTLHKVYLGQDGEVKVYANITIQLNSPINKDLLLDHNGTHIYIMTKNTVQKRPVAE
CGAHLDCWSCLSAIDPYCGWCVLQGRCGQHWECQQGSVQGQWIWSFNQTQQCLHIHHLSL
YNISLGEKSNIIVSVKGLPNLGKGEAYSCFFKDAQTQALFTTSGVICPTPDADSLPPIDH
GDEFVVLTLSLRFMNVIVAETEFTFYNCSLVQQLSGRRPCQGCVSSRWGCNWCIHQHVCT
HKQICSKGVTIFNRNVSQLVPLHSKNEKKPKKTIVIMAQICLYSLCDSFNSDVSQMSHKK
QKYQRATKKEVNMKSAETCKCLLISSRSVEDAYSNLQSFNIFTVVEICLNDSVNNIKLLK
HKTSKNNLFLYCTHQHSKHTAHIAFFVHQNFLIKKTLIQLISNHFPSLSGSDTRVIRYRL
KGVLKITTTLREINWYLSFFCVFCVSVILAVSYDSILLIFLDDFLHNIKKECPSVERVQG
SSLLPVSVERKITLLAKHLNVFQDKSLDYECVLEIENQSVVVDAAVEPDINQPSVFLIKC
QPNQYLYSVLMEEYTAMIIVRRKNKFRIDSAEDLYVNLFNCSVGRQDCSRCHTADPKYGC
VWCNGASASGCVYQGSCNGEVQVTCPAPVIHFLDPLSGPVEGGTVVTISGSNLGQRAEDV
QNSVTVAGIPCSVINSRYEVSSKIVCVTARSGQEKIGQALVKVQGGGLGLSAQIFSFQNP
VLSSISPRRGPRAGGSSITIRGWGLRTGHSSEVSVLIGEVPCMVLNIQEDKIICVTSGCN
RTGDYRVTVHFGGAERHLLGSVYHYTPNPNITMAAPTKSFLSGGRIIRVSGQNLDVVQEP
KMRVILSPPESLPPRRKRRLSSESYESQCCVNSSTLITCPSPAVGSEARRAKVKVLFLMD
SLHFDFTSVGIDNFNYEPNPKLYPLNRNNPTKPYHHKPGSIISVEGENLDLAIYKHEVQA
LIGEGVCSVKTLTHNNLYCEPPVQQPSIDANSKQEGMDNLPEFTVKMGNLNFSLGRVKYD
SQAPSIFPVEAQVGVGVGASIVALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRD
RCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRAYIERIFFPSHQESPLRRNLDVPENRRQT
VEQGLVQLSNLLNSKLFLTKFIHTLEVQRTFSPRDRAYVASLLTVALHGKLEYFTDILKT
LLNDLVEQYVAKNPKLMLRRTESVVEKLLTNWMSVCLFTFLQESAGESFYMLFRAIKHQV
DKGPVDVVTGKAKYTLNDNRLLREDVEYRTLTLNVVIPAAATCTGATSQIVPAKVLDCDT
ITQVKEKLVEQTWKGTSFSQRPHIDSLQLEWRAGVAGHLILSDEDLTSVVQGSWKRLNTL
QHYKVPDGATMALVLSKHHLHDSHDYMPGEKTPALDDGEEEGVRLWHLVKAREESELPKH
RKGSVRERGGERAKAIPEIYLTRLLFMKGTLQKFVDDLFTAILSTSRPVPLAVKYFFDLL
DEQALQHGITDPEIIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDAVLSVIAQTFMD
SCTIADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTIPASDQEMNSSLAEISRNY
TADINCLVALHDLYKYINKYYDQIITTLEEDTTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H2UK37
31033.ENSTRUP00000037308 ENSTRUP00000037308 ENSTRUP00000037308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]