SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039033 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039033
Domain Number 1 Region: 129-327
Classification Level Classification E-value
Superfamily ADP-ribosylation 3.38e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 11-101
Classification Level Classification E-value
Superfamily WWE domain 1.14e-18
Family WWE domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039033   Gene: ENSTRUG00000015275   Transcript: ENSTRUT00000039173
Sequence length 328
Comment pep:novel scaffold:FUGU4:scaffold_8:1006616:1008867:-1 gene:ENSTRUG00000015275 transcript:ENSTRUT00000039173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTRKYTPSEEESNENEEMDTSESNWCWFYLAECGVWHMFEIDPSASCSVTSAQIEQCYNR
NQRGVMEFYTAKYTYRLDFSMMRQINVTTGKQRPIKRSLHSATGFRFICDNLALPVPCHW
ERINTDEPYQLIQLGRDTHEFKEVARLYERTMDHPIKSIQRIQNLDLWEFFCRKKTQLQK
VKRTLDIEERMLFHGTGYSNIQAICTFNFDWRLTGSHGGVYGKGSYFARDAKYSSKFCHT
TGKHNITLQRHGLAPPIFASEPPYKTMFLARVLVGEYSVGHPMYCRPPSKDTSFTSFYDS
CVDDMANPKIYVIFDSNQIYPEYMIEFY
Download sequence
Identical sequences H2UQ12
31033.ENSTRUP00000039033 ENSTRUP00000039033 ENSTRUP00000039033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]