SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039458 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039458
Domain Number 1 Region: 235-343
Classification Level Classification E-value
Superfamily SH2 domain 3.37e-25
Family SH2 domain 0.00000366
Further Details:      
 
Domain Number 2 Region: 347-384
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000327
Family SOCS box-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039458   Gene: ENSTRUG00000015433   Transcript: ENSTRUT00000039599
Sequence length 385
Comment pep:known scaffold:FUGU4:scaffold_1:1096830:1097984:-1 gene:ENSTRUG00000015433 transcript:ENSTRUT00000039599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNMSEKKPKGSGTRPKCGFRSWSADSYIWRSKKRSRNGSTPSGLDSEGTEELGGRSTSCP
RRRRERMCSCTTLGDGPASADNDVVCRKALSRRSLRQKFQDAMGQCLPLRSHHHIHHHHP
PSSSRPFSVLFWSKRKIHVSELMQEKCPFSPKSELARCWHLIKKYAAHPTAMKDMEAPLK
PSVSSSSTSPPQTPLSWDDICCSPGPGNTSLEDWDPSCPHGGAEGRCNHTDYILVPDLLQ
ISNSPCYWGVLNRFEAEELLEGKPEGTFLLRDSAQDEYLFSVSFRRYSRSLHARIEQNDK
RFSFDVHDPCVYQDSSVTGLLRHYSDPATCLFFEPLLSSPLSRTFPFSLQHLCRTLICSR
TTYQGVESLPLPPQLRDYLRQYHIK
Download sequence
Identical sequences H2UR85
31033.ENSTRUP00000039458 ENSTRUP00000039458 ENSTRUP00000039458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]