SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000039547 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000039547
Domain Number 1 Region: 982-1275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.51e-80
Family Protein kinases, catalytic subunit 0.000000000265
Further Details:      
 
Domain Number 2 Region: 328-490
Classification Level Classification E-value
Superfamily L domain-like 9.07e-47
Family L domain 0.00000362
Further Details:      
 
Domain Number 3 Region: 33-195
Classification Level Classification E-value
Superfamily L domain-like 7.66e-41
Family L domain 0.00000141
Further Details:      
 
Domain Number 4 Region: 486-605
Classification Level Classification E-value
Superfamily Fibronectin type III 4.35e-33
Family Fibronectin type III 0.0000194
Further Details:      
 
Domain Number 5 Region: 795-939
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-21
Family Fibronectin type III 0.00013
Further Details:      
 
Domain Number 6 Region: 607-687,801-823
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-20
Family Fibronectin type III 0.00088
Further Details:      
 
Domain Number 7 Region: 236-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000039547   Gene: ENSTRUG00000015459   Transcript: ENSTRUT00000039688
Sequence length 1419
Comment pep:novel scaffold:FUGU4:scaffold_91:211453:243004:1 gene:ENSTRUG00000015459 transcript:ENSTRUT00000039688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRMERSHLTLFWGLMLGLSSCLRPAAAEICGPSIDIGNDISEFRRLENCTVVEGYLQI
LLIGDKNNNINQEIFRSLSFPKLTMITDFLLLFRVSGLDSLSTLFPNLTVIRGRNLFYNY
ALVIFEMTSLKDIGLYSLRNITRGAIRIEKNPELCYLDSVDWSVIMDAEFNNYIAGNKQS
KECSDVCPGIMESSPQCRKTMFNDNYNYRCWNSNHCQKECPEKCGQRDCTVDGECCHPQC
LGSCTLPGSDTACAACVHYYHQGRCVAECPPGTYKFEGWRCVSVEFCSKVHLPDPHTFVI
HGQECMPECPSGYTRSTTDNMSCTACDGLCDKVCEGEEKVIDSVDAAQSLKGCTVIKGNL
HINIRRGHNMVAELESFTGLIQRVKGYVRIRHSHTLNSLAFLRSLRYIDGENLLDDMYAF
SAFDNHQLQYLWDWSQHNLTIKTGKLFFRANPKLCMSEIHKMWEKTGIQGRFDESDFRNN
GDRASCESTILAFTSNSTSSTRIKLTWQRYRPPDYRDLISFIVYFKEAPYQNITEYEGQD
GCGSNSWNMVDVELRQDRDSDPGVLLSGLKPWTQYAVFVKAITLVVENKHVPSAKSKVVY
IRTRPSAPSMPQDVRAYSNSSTQLVVRWSPPVSANGNQTYYLVRWQQQAEDRELYQHNYC
SKELKLPIRIAATGVGDQEEDTKPTKPDADGPEKGPCCPCPKSVEDLEAEAADASYRKVF
ENFLHNSIFTPRPPDRRRRDVFGVANSTHWPHNRLPINNSTVSSVQAGSNSSSSSNSGDN
VEPVDREFEFTEQSVTERELQISGLKPFTVYRIDIHACNRQVQRCSAAEFVFSRTKPAEK
ADDIPGTVTWEGHEDWGFLRWPEPHHPNGLVLMYEIKFKLASESEKHECVSGQMYQTQRG
VRLSNLSPGNYSVRVRAISLAGNGSWTHILDLYVAESKPRRNVCFVDMIFIPIAIVFFIC
LLVTMLVVLNKKRNSDRLGNGVLYASVNPEYFSAAEMYVPDEWEVAREKICLSRELGQGS
FGMVYEGLAKGVVKDEPETRVAIKTVNESASMRERIEFLNEASVMKEFNCHHVVRLLGVV
SQGQPTLVIMELMTRGDLKSYLRSLRPKEQQWSSLSLPPLKKMLQMAGQIADGMAYLNAN
KFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVF
TTNSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLEKPQNCPDMLFELMRMCW
QYNPKMRPSFVEIISSIKDELEPSFSEVSFFYSADNKPAEAPQPHIDKLDNVDDILLDTP
SSSSSVQPQQTPVSQQTPPSPSSETPPAPSRAASSPSSPCTSTAAVDKQPSSQQAANGLS
GAGSDASARPSLDDLPPYAHMNGGRKNERAMPLPQSSAC
Download sequence
Identical sequences H2URH4
ENSTRUP00000039547 ENSTRUP00000039547 31033.ENSTRUP00000039547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]