SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040041 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040041
Domain Number 1 Region: 44-286
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.3e-49
Family Ankyrin repeat 0.00013
Further Details:      
 
Domain Number 2 Region: 288-327
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000112
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040041   Gene: ENSTRUG00000015664   Transcript: ENSTRUT00000040182
Sequence length 328
Comment pep:novel scaffold:FUGU4:scaffold_5:2994913:2999354:-1 gene:ENSTRUG00000015664 transcript:ENSTRUT00000040182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STRDLTNKPFAAQLSHVYLSILALFCFKLFVKISLNLLAYFYIVRGNRKEAARISAEFYD
YGQHRSWADRSPLHDAASQGRLLALRNLILQGHSVNVLTIDHVTPLHEACVGDHVACARA
LIDAGANVNALTIDGATPLFNACTVGSVACTEILLENGAQPQSLVYHPSPMHEATSKGHY
GCVEALLTWGADVDMDIPHLGTALYTACICQELECASKLLREGANVQKGKSLDSPLHAAA
EKDSTEVVKLLLDFGADINARNTEFQRPVDVAPPSSLTEGFLLLYEATPRLLSQLCRQCI
RNCVGRDRLHLLAHLPLPNRLRSYLQYH
Download sequence
Identical sequences H2USW8
ENSTRUP00000040041 ENSTRUP00000040041 31033.ENSTRUP00000040041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]