SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040723 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040723
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.54e-47
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 244-287
Classification Level Classification E-value
Superfamily SOCS box-like 0.000011
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040723   Gene: ENSTRUG00000015930   Transcript: ENSTRUT00000040865
Sequence length 289
Comment pep:novel scaffold:FUGU4:scaffold_66:1115061:1116142:-1 gene:ENSTRUG00000015930 transcript:ENSTRUT00000040865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTMWYIMQSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRKGADVNRMHGTLKPLHCA
CMVADADCVELLLHNGAEVNALDGYNRTALHYAAEKDESCVELLLEYGAQPDALDGNKDT
PLHWAAFKDNPECVKALLENGACPNARDYNNDTPLSWAAMKGNLESVKVLLDYGAQVHVT
NLKGQTPISRLVALLARGLGTEQEEECLDLLCQAAGRFEIRRADGTLPRELNKDPQLLAR
LTSMMAQAPTLRSLARCAVRQSLGVQFLPTAVKDLPLPETIKEYLLLRD
Download sequence
Identical sequences H2UUU8
31033.ENSTRUP00000040723 ENSTRUP00000040723 XP_003963148.1.43653 ENSTRUP00000040723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]