SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000040785 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000040785
Domain Number 1 Region: 60-330
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.83e-50
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 415-457
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000379
Family SOCS box-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000040785   Gene: ENSTRUG00000015951   Transcript: ENSTRUT00000040927
Sequence length 463
Comment pep:novel scaffold:FUGU4:scaffold_37:1634308:1636255:1 gene:ENSTRUG00000015951 transcript:ENSTRUT00000040927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPVPFTCSWVSGLLWAAFRRFLAGPAGLADPGPSFRELMEELRPRRAADKQLKQQFLD
ALRANNAQEVTRILHTGKLDIDTVMEVDDPSMVLASYKQGYWLPGYKLEKSWAMAVHVCA
MYGAVETALLLLEAGAAVNSMPNGKTPLHVACETSDADCVAVLLAHGAKVDSLSLSGHTP
LHYCVTARSVDCAEQLIAKGLNVNVPGQNTSEDTPLHTAARFGIPELAGLYLAHGASVDA
LNSLQETPLMTAAFWAFDSREQTYSREHHLVCRLLLDHRADPNLQDEDHKTALHKASWNC
DHVLMQMLLEAGADARAMDVNGCAPIQYLLKVTGVRPAATPELCFQLLLNHNAARIYPPQ
FHKVLQSCHDYPGVLEVLVNSYERLTPTRKWKAAVPDDCYKRHEAFYESMFAVCAHTPRS
LLHLTRCAIRAHLGAACHSGVARLPLPPLMRKYLLLDPEGTLY
Download sequence
Identical sequences H2UV10
31033.ENSTRUP00000040785 ENSTRUP00000040785 ENSTRUP00000040785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]