SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000041749 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000041749
Domain Number 1 Region: 58-419
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-61
Family Ankyrin repeat 0.0000294
Further Details:      
 
Domain Number 2 Region: 517-571
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000262
Family SOCS box-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000041749   Gene: ENSTRUG00000016327   Transcript: ENSTRUT00000041893
Sequence length 576
Comment pep:novel scaffold:FUGU4:scaffold_104:512329:515383:-1 gene:ENSTRUG00000016327 transcript:ENSTRUT00000041893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTHEEDGEDELSDYITQLNIHESCQESFLKSAARYHTTFHLAAETDENLRVLAAIDQGE
VLVLTDLLKGSGAFREWDSRGCLPLHRAAVQPVLEVLKTVLRSATQRLSLEERTAAAEGE
TPLTLAVIAGLTHNVRTLLEHGASPHNTNGKKESPLMLAVKAGSYEMTHLLITYGAWAEQ
VCWRNWTATHEAAKLGNTDILMLLLRNGGRVNHKDVTGATPLAVAAEYGHAHIAEVLLSC
GSRINSQACNGESVLLDAAGSGNTACIQLLLDNGADANLPNATGHLPIHKAAYAGHYQAV
KMLIPLTTKKAIKEAGQSPVHSAAEGGHRRCLELLLAHGFDVNYRMDARKSETYRDMRRT
ALYFAVSNGDVECTRILLASGAKTDLDPLCCLLVAVRSGCYDIVKLLLASKADVNRYFTV
VSDTLFPTALQYCLKDEVMMRLLLNNGYDVEKCFQCHHDNASDTGDEGQRKIPFCEFMSL
CCVLHLSGKVVLILLDYTSHVHICSRLGAILEKQSEWPEIRRVLGTPRSLGHLCRLRMRR
SLTLKRLNNLEIMNSLIIPPGLQRFLLYQELDLYTS
Download sequence
Identical sequences H2UXS0
ENSTRUP00000041749 31033.ENSTRUP00000041749 ENSTRUP00000041749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]