SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042300 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042300
Domain Number 1 Region: 1051-1245
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000596
Further Details:      
 
Domain Number 2 Region: 839-961
Classification Level Classification E-value
Superfamily PH domain-like 1.56e-29
Family Pleckstrin-homology domain (PH domain) 0.0000357
Further Details:      
 
Domain Number 3 Region: 44-168
Classification Level Classification E-value
Superfamily PDZ domain-like 6.18e-20
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042300   Gene: ENSTRUG00000016547   Transcript: ENSTRUT00000042444
Sequence length 1343
Comment pep:novel scaffold:FUGU4:scaffold_15:1999871:2014446:1 gene:ENSTRUG00000016547 transcript:ENSTRUT00000042444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YITVRCVVRSRTSTPSSPACLAKGRRDGVSSAPDNPRPPMATRPGREGVSVGWRGPRTLV
LHKNSQGFGFTLRHFIVYPPESTLHANLKDEENGNEKGYQKSRMEPMDTIFVKSVRERGP
AHQAGLCTGDRLVKVNGESVLGKTYSQVIALIQNSESVLELSIMPKDEDVLQLAYSQDAY
LTGNEPYSGGAENLPPPPPLCYPRSKAAPVSGAPVSAPMGQNQLDNWSRWPNSSSPSSPL
DNCSTVGSPASWQEGRPGEPGGVGPSSPAHRTEEIQYGMTGKHPQGQTRGRSYSSSSSSG
GLLSSPLQVHYPNHHAASTSQAPPRKSSPAWTSPPLPQLSHSRNERCQQALSDWYHNQIP
ERPGRSNQMRHRSYSQDRLSDMRRQQQRAGDWPHSASQDTLLFLQQQQSGPGPRGEPYWS
YSDWDGTAGRGPLAPDYTRTRSENLLAQFDCHGRSLEMLDRAAGPVSPRFERPSWIQQIP
QPPHRTDAYPRQGNHYGAAQAPPISRHPTHHSQTPSQPQPPQAASQRRRLPPGQSMDDQP
VGYRSYSPSFYRKTGRIMQQAHSFRDPSYSGPHLNWNPSPKSPPEGDTAPMTATVASPLT
STAPETQNREYRPTNHERDQGSKDKGQEEALVQTQEVVLRQKPPTGRRNAFGMRHPHYAL
PADGLEPSLFSAEDSAPAPTSKEEGAPRKPNGNLAPLPIEDDSLASIPFIDEPTSPSADL
RARHVPASSVVSSGMSSAPAMVTSPSSPTFHFPPTRLFSHDCSSIKSSRRSSYLLAITAE
RSKSCDEGLNTFREEGRVFSLFPLVLVVLQSLDNLRSAEEVRSKRHSTSELGNIAYSDVR
REGWLHYKQILTEKGKKVGSGMRPWKRVFSVLRSHSLFLYKDKREAVLRGATIGGGTEDE
QPISIRGCLVDIAYSETKRKHALRLTTQDFCEYLLQAEDREDMLDWIKVIRENSKTGSEE
LGFSGQALISKKLNDYSSPCSPTGNKPDSSPRLSRMKPPFLLAKTENSTGAPRSPKPEGK
ASVIYKDIRPPDYSPWGINIMKKTKKVVPKAFGVRLEDCQPGVNNKFIPLIVEICCGLVE
EMGLEYTGIYRVPGNNAMVSLLQEQLNKGVDINPAEEKWQDLNVVSSLLKSFFRKLPEPL
FTNDKYNDFIDANRMDDASERLKTLKKLIRDLPDHYYHTLKFLIGHLKTVADNSDKNKME
PRNLALVFGPTLVRTSEDNMKEMVTHMPDRYKIVETLIQHGIWFFTDELDKDEKVSNAAF
TTRLSTEPAPNIDHLLPNIGRTGLPGEASDSTNSDSAKSKGSWGSKKDLSPKDFLTLSIM
TAVTGRKRRKRHNAWRVGSSTDD
Download sequence
Identical sequences H2UZC1
31033.ENSTRUP00000042300 ENSTRUP00000042300 ENSTRUP00000042300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]