SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000042502 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000042502
Domain Number 1 Region: 67-411
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.58e-58
Family Ankyrin repeat 0.0000233
Further Details:      
 
Domain Number 2 Region: 525-578
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000837
Family SOCS box-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000042502   Gene: ENSTRUG00000016616   Transcript: ENSTRUT00000042646
Sequence length 585
Comment pep:novel scaffold:FUGU4:scaffold_8:2283067:2286988:1 gene:ENSTRUG00000016616 transcript:ENSTRUT00000042646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDLEQDSINQELIEFALQESIQDLNKSAKTSSCIRTEPHSEAFTKIMAAIRRGDSCALQ
QQAARPSAYRERDSRGRLPLHVAAPRPQPDVLRAVLQGTASAHLTLEGQTGEGDTPLTLA
VAAGLVDNVKILLGHGASPHNTNSRNESPLLIAVRQRSYDMVLTLLMGGAFVEQVCWTKW
TATHEAAKVGCADVLTQLLRHGAKVNSRDGHGVTPLAIAAEHGNTEALDVLIQHGGDVNA
QATNGDSVLYDAAGSGNLDTVELLLQHGADPNVASFAFQLPIHRASYEGHILVLRTLIPI
TSERAIHLSGQDPIHSATDGGQVECLRLLIQEGRDVNALLGTHISENYGDLRKTPLFFAI
SNGDVTCAKLLLAAGARTELDPLRCILVAVRAERHDLVQLLLSYGADVNCYFRVISNTLF
PTALQYCLSDHIMMRLLLNSGYQAYKCFQCFHGDDRGVDSRWIDLRNRVYQIYSQPDVIT
FCEFVSVSWLTHLVGGTVRTLLDYVSYVSICPKLRRILKMGPEWEEISDILSKPRTLQHL
CRLAIRGNMSLTTLNDPRAMAAVPLPPTLQNYVTFRSFSQHTDLT
Download sequence
Identical sequences H2UZX2
ENSTRUP00000042502 ENSTRUP00000042502 31033.ENSTRUP00000042502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]