SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000043023 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000043023
Domain Number 1 Region: 195-314
Classification Level Classification E-value
Superfamily PH domain-like 3.31e-30
Family Pleckstrin-homology domain (PH domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 340-453
Classification Level Classification E-value
Superfamily SH2 domain 7.81e-25
Family SH2 domain 0.0000396
Further Details:      
 
Domain Number 3 Region: 23-80
Classification Level Classification E-value
Superfamily Phenylalanine zipper 1.7e-17
Family Adapter protein APS, dimerisation domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000043023   Gene: ENSTRUG00000016798   Transcript: ENSTRUT00000043168
Sequence length 580
Comment pep:novel scaffold:FUGU4:scaffold_7:3143567:3159008:1 gene:ENSTRUG00000016798 transcript:ENSTRUT00000043168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGNTIYPHNTTTVVGGGPAPVRGWREFCELHAIATARQLAGHYRSFARERPQQDVLPPE
LFSKQFTDLFQQHFCCEVDKDGMPISPNMCSIAAGNASSTPPAASPHPTQGLSDPTDCAT
SSEEATPAQPSLVPGPDSYQPKPKQQRQHNEQSSSSPSPSLSTSCLNSEATPPASTHVSV
ARFASQLRLSLDRFHLSGCCKEGQLRYLPVDDTISDNQPHWQRCRLLVRRISDSQGEKYV
LELYDPPKASSPKLTTQCSDIQEVRRCNRLEMPDNINTFVLKVSQGSLIFETDNDQQVSS
WTTEIKECINNRSGGADLEPLPSPPDVSAPSSQRGSTELSSQGPAPLPMPEQVVQKTDHF
LFSYPWFHGPISRVKAAYLVQSSGPEGHGVFLVRQSETRRGDYVLTFNYQGKAKHLRLSL
TEWGQCRVQHLRFPSVMDMLSHFRLFPIPLECGAAGAVTLSSFVVASSSSPTQGALLVPF
SLHRWSSEPSLAHCSLARTSGQPPSSCSTSSSHSSVSHPGNQAPTRPDPTPPAPVPLRRS
ESVGRRPLLRHSHIPQRDSDYELEPDRGRKRAVDNQYMLL
Download sequence
Identical sequences H2V1E3
31033.ENSTRUP00000043023 ENSTRUP00000043023 ENSTRUP00000043023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]