SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044000 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044000
Domain Number 1 Region: 25-250
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.07e-36
Family Ankyrin repeat 0.00052
Further Details:      
 
Domain Number 2 Region: 267-315
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000235
Family SOCS box-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044000   Gene: ENSTRUG00000017179   Transcript: ENSTRUT00000044148
Sequence length 321
Comment pep:novel scaffold:FUGU4:scaffold_3:3876666:3878017:-1 gene:ENSTRUG00000017179 transcript:ENSTRUT00000044148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLYYVLIDRFSVRSMLHLRTSEEEHSSFEISKLRQAVLQNNDRLLDEMLCQEIYKKV
INCRGGWGIAGTPLHAAVSKGHLNCLQVLLAHGALVDCVDVKAQTPLFTAVRGKYLDCVL
ALLRAGANPNGSSSNNCSPVLTAAREGDVEILKELLKCGAEVNSRSKVLLWTSSARVSSG
PLYLAAVYGHLECFKLLLLYGADPDYNCADANLLSSIKQPKTVLEMCLRHGCGVEYIQLL
IDFGANVYLPTLIIEKSTKQNEAVELLLHERGNPKALTSQCRLAVRRYLKKIDKIHCIDQ
LEMPPSLINFLQHKPGPVLSF
Download sequence
Identical sequences H2V466
31033.ENSTRUP00000044000 ENSTRUP00000044000 ENSTRUP00000044000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]