SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTRUP00000044664 from Takifugu rubripes 69_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTRUP00000044664
Domain Number 1 Region: 267-514
Classification Level Classification E-value
Superfamily Caspase-like 4.64e-77
Family Caspase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 88-170
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000589
Family DEATH effector domain, DED 0.022
Further Details:      
 
Domain Number 3 Region: 1-78
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000008
Family DEATH effector domain, DED 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTRUP00000044664   Gene: ENSTRUG00000017426   Transcript: ENSTRUT00000044815
Sequence length 519
Comment pep:known scaffold:FUGU4:scaffold_100:177074:180721:1 gene:ENSTRUG00000017426 transcript:ENSTRUT00000044815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFQARLLKVGNDLRKDEVRALVFLCSDILGCNPAAVQSAGDLFSRLSDQDHLSEEQPHL
LVELLGIIQRTKLLRDHNLPRTGAQDLISPYRKLLYSLSEELTADDLKDIKFLLNNKLPR
GKLEEVTTLEVFMELEHRALISDTDLGFLESIIQPVCPVLLEKINQFNAQNCKFYLFTIF
KLQDASDPLKALWLIKKFDSFLVSFSSNESWIGGSVVLFQHPAGKPDLPRSGDVRDRQRR
CSKYENPNPEVLVLSAVGCPDVSVQGVETYLMTAAKRGRCLIINNCNFRVSRLKKREGTM
VDEASLDKVLKWLGFEVEIQRDCTSKKMSSLIQELAKTSQRDWDCVMCCVLSHGLEGGVY
GVDGGTVEIRKLMEPFSGTNCPSLAGKPKIFFIQACQGSRQQDIVYTDAGTPGHGYVDNN
AVQAKECIPSHADFLLGMATVPSFVSFRDGTHGTWYIQSLCQNLADMVPRGCDLISILTK
VNADVSKKVAWIDSGHKTQMPQPAFTLTKKIVFPAPNTP
Download sequence
Identical sequences H2V630
ENSTRUP00000044664 ENSTRUP00000044664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]